MS015178.1 (mRNA) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GAGACTGCATCACTTTCCTTTGGTAACTCTTTTGGTTTCCCAAGGATAGAGGTAGTTGGGGCAAAGCCCACTTTCTTCGCTCTGCGAATGAGAACTAAACTCAGAGGAAAAAACACATTCTCTCTTTGCGAGGTCCAAAAA GAGACTGCATCACTTTCCTTTGGTAACTCTTTTGGTTTCCCAAGGATAGAGGTAGTTGGGGCAAAGCCCACTTTCTTCGCTCTGCGAATGAGAACTAAACTCAGAGGAAAAAACACATTCTCTCTTTGCGAGGTCCAAAAA GAGACTGCATCACTTTCCTTTGGTAACTCTTTTGGTTTCCCAAGGATAGAGGTAGTTGGGGCAAAGCCCACTTTCTTCGCTCTGCGAATGAGAACTAAACTCAGAGGAAAAAACACATTCTCTCTTTGCGAGGTCCAAAAA ETASLSFGNSFGFPRIEVVGAKPTFFALRMRTKLRGKNTFSLCEVQK Homology
BLAST of MS015178.1 vs. NCBI nr
Match: YP_009913619.1 (ribosomal protein L2 [Luffa acutangula] >QLJ93019.1 ribosomal protein L2 [Luffa acutangula]) HSP 1 Score: 83.6 bits (205), Expect = 5.1e-13 Identity = 40/47 (85.11%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MS015178.1 vs. NCBI nr
Match: YP_003587229.1 (ribosomal protein L2 [Citrullus lanatus] >ACV96645.1 ribosomal protein L2 [Citrullus lanatus]) HSP 1 Score: 83.2 bits (204), Expect = 6.6e-13 Identity = 39/47 (82.98%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MS015178.1 vs. NCBI nr
Match: WP_131747056.1 (hypothetical protein [Candidatus Frankia meridionalis]) HSP 1 Score: 82.4 bits (202), Expect = 1.1e-12 Identity = 39/47 (82.98%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MS015178.1 vs. NCBI nr
Match: DAD25556.1 (TPA_asm: hypothetical protein HUJ06_027020 [Nelumbo nucifera]) HSP 1 Score: 82.4 bits (202), Expect = 1.1e-12 Identity = 39/47 (82.98%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MS015178.1 vs. NCBI nr
Match: QXX99528.1 (ribosomal protein L2 [Macadamia integrifolia] >QXX99570.1 ribosomal protein L2 [Macadamia ternifolia] >QXX99612.1 ribosomal protein L2 [Macadamia tetraphylla]) HSP 1 Score: 82.4 bits (202), Expect = 1.1e-12 Identity = 39/47 (82.98%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MS015178.1 vs. ExPASy Swiss-Prot
Match: P93311 (60S ribosomal protein L2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RPL2 PE=1 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 2.1e-14 Identity = 37/47 (78.72%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of MS015178.1 vs. ExPASy Swiss-Prot
Match: P0C8K6 (60S ribosomal protein L2, mitochondrial OS=Oryza sativa OX=4530 GN=RPL2 PE=3 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 9.0e-13 Identity = 35/47 (74.47%), Postives = 38/47 (80.85%), Query Frame = 0
BLAST of MS015178.1 vs. ExPASy Swiss-Prot
Match: Q2F969 (60S ribosomal protein L2, mitochondrial OS=Oryza sativa subsp. indica OX=39946 GN=RPL2 PE=3 SV=2) HSP 1 Score: 73.2 bits (178), Expect = 9.0e-13 Identity = 35/47 (74.47%), Postives = 38/47 (80.85%), Query Frame = 0
BLAST of MS015178.1 vs. ExPASy Swiss-Prot
Match: P92812 (60S ribosomal protein L2, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=RPL2 PE=2 SV=2) HSP 1 Score: 73.2 bits (178), Expect = 9.0e-13 Identity = 35/47 (74.47%), Postives = 38/47 (80.85%), Query Frame = 0
BLAST of MS015178.1 vs. ExPASy TrEMBL
Match: A0A7D5XZ32 (Ribosomal protein L2 OS=Luffa acutangula OX=56866 GN=rpl2 PE=3 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 2.5e-13 Identity = 40/47 (85.11%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MS015178.1 vs. ExPASy TrEMBL
Match: D5I399 (Ribosomal protein L2 OS=Citrullus lanatus OX=3654 GN=rpl2 PE=3 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 3.2e-13 Identity = 39/47 (82.98%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MS015178.1 vs. ExPASy TrEMBL
Match: B6VJV4 (Ribosomal protein L2 OS=Vitis vinifera OX=29760 GN=rpl2 PE=3 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 5.5e-13 Identity = 39/47 (82.98%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MS015178.1 vs. ExPASy TrEMBL
Match: Q5MF17 (Ribosomal protein L2 (Fragment) OS=Platanus occidentalis OX=4403 GN=rpl2 PE=3 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 5.5e-13 Identity = 39/47 (82.98%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MS015178.1 vs. ExPASy TrEMBL
Match: A5BK62 (Ribosomal_L2 domain-containing protein OS=Vitis vinifera OX=29760 GN=VITISV_029794 PE=3 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 5.5e-13 Identity = 39/47 (82.98%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MS015178.1 vs. TAIR 10
Match: AT2G07715.1 (Nucleic acid-binding, OB-fold-like protein ) HSP 1 Score: 78.6 bits (192), Expect = 1.5e-15 Identity = 37/47 (78.72%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of MS015178.1 vs. TAIR 10
Match: ATMG00560.1 (Nucleic acid-binding, OB-fold-like protein ) HSP 1 Score: 78.6 bits (192), Expect = 1.5e-15 Identity = 37/47 (78.72%), Postives = 41/47 (87.23%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|