![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Carg18880-RA (mRNA) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AAACCCTAGAATTTGCAGCCACCGCTGGGTCCGAGGTTTGTTCTACTACTCTCCTTCCATTGATTTCATTTACTACGAAATTTGGCGTAGCTTTAGTTTTCTGATTTCACTTTCTCGTTTCTGCTTTTTTATTCTGTGATATTTAGAAATGGCCAAGTCGAAGAATCACACAGCGCACAATCAGTCCCGAAAAGCCCATAGGAATGGCATCAAGAAGCCAAGGAAGCACCGCCACACTTCCACCAAAGGGGTACGAAATACATGAACGAAATCATTGTTTTTCTTTTTGGTTCGATTATTTCATATAGAATGTTACTTCAAAATTGTTTGGCTTTATTTGATAGTGTTTTGTCGATCTGTGTGTAGATGGATCCCAAGTTTCTGAGGAATCAAAGGTACGCCAAGAAACACAACAACAAGAGTGGTGAAAGCGGTACTGAGGAAGAGTAATTTAGAACGCCGTTAATTTGAATTTCGAGTCTGCTTCGATTGAACATTTTTATGTCTCTGCCCTTTTTGTTCATTAGTATAGTTATTTTTACTTGAATTTAACGAGTCCTGTTACGACTATCGATTAACCTGTTCTGGAAGTTCAATTTTTTAGTGATTGATTGTGTTTTCACACTCATTTCTGCATTCTCTCTTGTTTCTTCTTCTTCTGGTTTTAATGGATCCTAATGTTGTCAGTTCATTGCTGACACTTGTTTCTTTCAAATGCATTATGATTTCTTTTTTTGG AAACCCTAGAATTTGCAGCCACCGCTGGGTCCGAGAAATGGCCAAGTCGAAGAATCACACAGCGCACAATCAGTCCCGAAAAGCCCATAGGAATGGCATCAAGAAGCCAAGGAAGCACCGCCACACTTCCACCAAAGGGATGGATCCCAAGTTTCTGAGGAATCAAAGGTACGCCAAGAAACACAACAACAAGAGTGGTGAAAGCGGTACTGAGGAAGAGTAATTTAGAACGCCGTTAATTTGAATTTCGAGTCTGCTTCGATTGAACATTTTTATGTCTCTGCCCTTTTTGTTCATTAGTATAGTTATTTTTACTTGAATTTAACGAGTCCTGTTACGACTATCGATTAACCTGTTCTGGAAGTTCAATTTTTTAGTGATTGATTGTGTTTTCACACTCATTTCTGCATTCTCTCTTGTTTCTTCTTCTTCTGGTTTTAATGGATCCTAATGTTGTCAGTTCATTGCTGACACTTGTTTCTTTCAAATGCATTATGATTTCTTTTTTTGG ATGGCCAAGTCGAAGAATCACACAGCGCACAATCAGTCCCGAAAAGCCCATAGGAATGGCATCAAGAAGCCAAGGAAGCACCGCCACACTTCCACCAAAGGGATGGATCCCAAGTTTCTGAGGAATCAAAGGTACGCCAAGAAACACAACAACAAGAGTGGTGAAAGCGGTACTGAGGAAGAGTAA MAKSKNHTAHNQSRKAHRNGIKKPRKHRHTSTKGMDPKFLRNQRYAKKHNNKSGESGTEEE Homology
BLAST of Carg18880-RA vs. NCBI nr
Match: XP_023000056.1 (60S ribosomal protein L29-1-like [Cucurbita maxima] >KAG7026347.1 60S ribosomal protein L29-1 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 119.4 bits (298), Expect = 1.1e-23 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of Carg18880-RA vs. NCBI nr
Match: XP_023514068.1 (60S ribosomal protein L29-1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 117.9 bits (294), Expect = 3.2e-23 Identity = 60/61 (98.36%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Carg18880-RA vs. NCBI nr
Match: KAG7013674.1 (60S ribosomal protein L29-1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 116.7 bits (291), Expect = 7.0e-23 Identity = 59/61 (96.72%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of Carg18880-RA vs. NCBI nr
Match: XP_022930442.1 (60S ribosomal protein L29-1-like [Cucurbita moschata]) HSP 1 Score: 116.7 bits (291), Expect = 7.0e-23 Identity = 60/61 (98.36%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Carg18880-RA vs. NCBI nr
Match: XP_022959482.1 (60S ribosomal protein L29-1-like [Cucurbita moschata] >XP_022959483.1 60S ribosomal protein L29-1-like [Cucurbita moschata] >XP_023006357.1 60S ribosomal protein L29-1-like [Cucurbita maxima] >XP_023006358.1 60S ribosomal protein L29-1-like [Cucurbita maxima] >XP_023549485.1 60S ribosomal protein L29-1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 116.7 bits (291), Expect = 7.0e-23 Identity = 59/61 (96.72%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of Carg18880-RA vs. ExPASy Swiss-Prot
Match: Q9M7X7 (60S ribosomal protein L29-1 OS=Arabidopsis thaliana OX=3702 GN=RPL29A PE=1 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 2.6e-20 Identity = 49/61 (80.33%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of Carg18880-RA vs. ExPASy Swiss-Prot
Match: Q84WM0 (60S ribosomal protein L29-2 OS=Arabidopsis thaliana OX=3702 GN=RPL29B PE=3 SV=2) HSP 1 Score: 98.2 bits (243), Expect = 3.4e-20 Identity = 50/61 (81.97%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of Carg18880-RA vs. ExPASy Swiss-Prot
Match: Q58DW3 (60S ribosomal protein L29 OS=Bos taurus OX=9913 GN=RPL29 PE=2 SV=3) HSP 1 Score: 80.5 bits (197), Expect = 7.3e-15 Identity = 41/52 (78.85%), Postives = 44/52 (84.62%), Query Frame = 0
BLAST of Carg18880-RA vs. ExPASy Swiss-Prot
Match: P47914 (60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2) HSP 1 Score: 80.5 bits (197), Expect = 7.3e-15 Identity = 41/52 (78.85%), Postives = 44/52 (84.62%), Query Frame = 0
BLAST of Carg18880-RA vs. ExPASy Swiss-Prot
Match: Q8HXB8 (60S ribosomal protein L29 OS=Macaca fascicularis OX=9541 GN=RPL29 PE=2 SV=3) HSP 1 Score: 80.5 bits (197), Expect = 7.3e-15 Identity = 41/52 (78.85%), Postives = 44/52 (84.62%), Query Frame = 0
BLAST of Carg18880-RA vs. ExPASy TrEMBL
Match: A0A6J1KET9 (60S ribosomal protein L29 OS=Cucurbita maxima OX=3661 GN=LOC111494363 PE=3 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 5.2e-24 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of Carg18880-RA vs. ExPASy TrEMBL
Match: A0A6J1L4P4 (60S ribosomal protein L29 OS=Cucurbita maxima OX=3661 GN=LOC111499112 PE=3 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 3.4e-23 Identity = 59/61 (96.72%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of Carg18880-RA vs. ExPASy TrEMBL
Match: A0A6J1H4N3 (60S ribosomal protein L29 OS=Cucurbita moschata OX=3662 GN=LOC111460442 PE=3 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 3.4e-23 Identity = 59/61 (96.72%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of Carg18880-RA vs. ExPASy TrEMBL
Match: A0A6J1EQI3 (60S ribosomal protein L29 OS=Cucurbita moschata OX=3662 GN=LOC111436885 PE=3 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 3.4e-23 Identity = 60/61 (98.36%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Carg18880-RA vs. ExPASy TrEMBL
Match: A0A6J1L1Y3 (60S ribosomal protein L29 OS=Cucurbita maxima OX=3661 GN=LOC111499113 PE=3 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 5.8e-23 Identity = 59/61 (96.72%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of Carg18880-RA vs. TAIR 10
Match: AT3G06700.1 (Ribosomal L29e protein family ) HSP 1 Score: 98.6 bits (244), Expect = 1.8e-21 Identity = 49/61 (80.33%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of Carg18880-RA vs. TAIR 10
Match: AT3G06700.2 (Ribosomal L29e protein family ) HSP 1 Score: 98.6 bits (244), Expect = 1.8e-21 Identity = 49/61 (80.33%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of Carg18880-RA vs. TAIR 10
Match: AT3G06700.3 (Ribosomal L29e protein family ) HSP 1 Score: 98.6 bits (244), Expect = 1.8e-21 Identity = 49/61 (80.33%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of Carg18880-RA vs. TAIR 10
Match: AT3G06680.1 (Ribosomal L29e protein family ) HSP 1 Score: 98.2 bits (243), Expect = 2.4e-21 Identity = 50/61 (81.97%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of Carg18880-RA vs. TAIR 10
Match: AT3G06680.2 (Ribosomal L29e protein family ) HSP 1 Score: 98.2 bits (243), Expect = 2.4e-21 Identity = 50/61 (81.97%), Postives = 55/61 (90.16%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|