
Cmc07g0192511 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTAACATTCCCTATGCTTCTGCTGTTGGGAGCCTGATGTACGCAATGTTATGTACTAGACCTGACATTTGCTATTCAGTAGGGATTGTTAGTAGATATCAGTCCAATCCTAGACGTGATCATTGGACAGCCGTTAAGAATATTCTAAAATATCTTATAAGAACAAAACACTACATGTTTGTGTATGGTTCTAAGGATCTGATCCTTACTGGATACACTGACTCCGATTTTCAAACTGATCAAGATGCTATAAAGTCTACATCAGGATCAGTTTTCACTTTGAACGAAGGAGCAGTAGTATGGAGAAGCATAAAACAATCTTGGAAGCTGAATATGTAG ATGAGTAACATTCCCTATGCTTCTGCTGTTGGGAGCCTGATGTACGCAATGTTATGTACTAGACCTGACATTTGCTATTCAGTAGGGATTGTTAGTAGATATCAGTCCAATCCTAGACGTGATCATTGGACAGCCGTTAAGAATATTCTAAAATATCTTATAAGAACAAAACACTACATGTTTGTGTATGGTTCTAAGGATCTGATCCTTACTGGATACACTGACTCCGATTTTCAAACTGATCAAGATGCTATAAAGTCTACATCAGGATCAGTTTTCACTTTGAACGAAGGAGCAGTAGTATGGAGAAGCATAAAACAATCTTGGAAGCTGAATATGTAG ATGAGTAACATTCCCTATGCTTCTGCTGTTGGGAGCCTGATGTACGCAATGTTATGTACTAGACCTGACATTTGCTATTCAGTAGGGATTGTTAGTAGATATCAGTCCAATCCTAGACGTGATCATTGGACAGCCGTTAAGAATATTCTAAAATATCTTATAAGAACAAAACACTACATGTTTGTGTATGGTTCTAAGGATCTGATCCTTACTGGATACACTGACTCCGATTTTCAAACTGATCAAGATGCTATAAAGTCTACATCAGGATCAGTTTTCACTTTGAACGAAGGAGCAGTAGTATGGAGAAGCATAAAACAATCTTGGAAGCTGAATATGTAG MSNIPYASAVGSLMYAMLCTRPDICYSVGIVSRYQSNPRRDHWTAVKNILKYLIRTKHYMFVYGSKDLILTGYTDSDFQTDQDAIKSTSGSVFTLNEGAVVWRSIKQSWKLNM Homology
BLAST of Cmc07g0192511 vs. NCBI nr
Match: TYK14490.1 (gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 199.5 bits (506), Expect = 1.5e-47 Identity = 101/119 (84.87%), Postives = 106/119 (89.08%), Query Frame = 0
BLAST of Cmc07g0192511 vs. NCBI nr
Match: TYK11050.1 (gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 199.5 bits (506), Expect = 1.5e-47 Identity = 97/108 (89.81%), Postives = 102/108 (94.44%), Query Frame = 0
BLAST of Cmc07g0192511 vs. NCBI nr
Match: KAA0026227.1 (gag/pol protein [Cucumis melo var. makuwa] >TYK30725.1 gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 199.5 bits (506), Expect = 1.5e-47 Identity = 99/109 (90.83%), Postives = 102/109 (93.58%), Query Frame = 0
BLAST of Cmc07g0192511 vs. NCBI nr
Match: KAA0046768.1 (gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 198.4 bits (503), Expect = 3.4e-47 Identity = 98/108 (90.74%), Postives = 100/108 (92.59%), Query Frame = 0
BLAST of Cmc07g0192511 vs. NCBI nr
Match: TYK06386.1 (gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 196.4 bits (498), Expect = 1.3e-46 Identity = 98/108 (90.74%), Postives = 99/108 (91.67%), Query Frame = 0
BLAST of Cmc07g0192511 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 7.7e-26 Identity = 56/104 (53.85%), Postives = 75/104 (72.12%), Query Frame = 0
BLAST of Cmc07g0192511 vs. ExPASy Swiss-Prot
Match: P0CV72 (Secreted RxLR effector protein 161 OS=Plasmopara viticola OX=143451 GN=RXLR161 PE=2 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 2.2e-20 Identity = 49/108 (45.37%), Postives = 72/108 (66.67%), Query Frame = 0
BLAST of Cmc07g0192511 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.7e-12 Identity = 41/103 (39.81%), Postives = 57/103 (55.34%), Query Frame = 0
BLAST of Cmc07g0192511 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 69.3 bits (168), Expect = 3.1e-11 Identity = 40/111 (36.04%), Postives = 62/111 (55.86%), Query Frame = 0
BLAST of Cmc07g0192511 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 7.0e-11 Identity = 40/103 (38.83%), Postives = 57/103 (55.34%), Query Frame = 0
BLAST of Cmc07g0192511 vs. ExPASy TrEMBL
Match: A0A5A7SNE2 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold343G00570 PE=4 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 7.4e-48 Identity = 99/109 (90.83%), Postives = 102/109 (93.58%), Query Frame = 0
BLAST of Cmc07g0192511 vs. ExPASy TrEMBL
Match: A0A5D3CST8 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold15G00010 PE=4 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 7.4e-48 Identity = 101/119 (84.87%), Postives = 106/119 (89.08%), Query Frame = 0
BLAST of Cmc07g0192511 vs. ExPASy TrEMBL
Match: A0A5D3CI71 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold73G00330 PE=4 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 7.4e-48 Identity = 97/108 (89.81%), Postives = 102/108 (94.44%), Query Frame = 0
BLAST of Cmc07g0192511 vs. ExPASy TrEMBL
Match: A0A5A7TV73 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold216G00520 PE=4 SV=1) HSP 1 Score: 198.4 bits (503), Expect = 1.6e-47 Identity = 98/108 (90.74%), Postives = 100/108 (92.59%), Query Frame = 0
BLAST of Cmc07g0192511 vs. ExPASy TrEMBL
Match: A0A5A7VMF5 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold352G00220 PE=4 SV=1) HSP 1 Score: 196.4 bits (498), Expect = 6.3e-47 Identity = 97/108 (89.81%), Postives = 100/108 (92.59%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|