Cmc05g0138891 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGTGGCATTGCAAATTAGGCCACATGTCTGAACAAGGATTAAAAGTTCTTGTAGAGCAAAATCTACTCCCAGGGCTCACTAAGGTGTCTTTACCCTTTTGTAAGCATTGTATTACAAGTAAGCAACACAGATTGAAGTTCAATACATCAAGTTCTAGAAGTAAAGTGATTCTAGAACTAGTTAATTCTGATGTATGGCAATCACCGGTTACATCTCTAGGAGGAGCAAGGTACTTTGTGTCCTTTATAGATGATTTCTCCAGAAGGTGTTGGGTGTATCCTATTAAGAAGAAGGCAGATGTATGTTCCATCTTCAAAGTATTCAAAGCGCAAGTGGAACTTCAATTTGGTAAAAAGATCAAGTGCTTTACGAACAGATAA ATGATGTGGCATTGCAAATTAGGCCACATGTCTGAACAAGGATTAAAAGTTCTTGTAGAGCAAAATCTACTCCCAGGGCTCACTAAGGTGTCTTTACCCTTTTGTAAGCATTGTATTACAAGTAAGCAACACAGATTGAAGTTCAATACATCAAGTTCTAGAAGTAAAGTGATTCTAGAACTAGTTAATTCTGATGTATGGCAATCACCGGTTACATCTCTAGGAGGAGCAAGGTACTTTGTGTCCTTTATAGATGATTTCTCCAGAAGGTGTTGGGTGTATCCTATTAAGAAGAAGGCAGATGTATGTTCCATCTTCAAAGTATTCAAAGCGCAAGTGGAACTTCAATTTGGTAAAAAGATCAAGTGCTTTACGAACAGATAA ATGATGTGGCATTGCAAATTAGGCCACATGTCTGAACAAGGATTAAAAGTTCTTGTAGAGCAAAATCTACTCCCAGGGCTCACTAAGGTGTCTTTACCCTTTTGTAAGCATTGTATTACAAGTAAGCAACACAGATTGAAGTTCAATACATCAAGTTCTAGAAGTAAAGTGATTCTAGAACTAGTTAATTCTGATGTATGGCAATCACCGGTTACATCTCTAGGAGGAGCAAGGTACTTTGTGTCCTTTATAGATGATTTCTCCAGAAGGTGTTGGGTGTATCCTATTAAGAAGAAGGCAGATGTATGTTCCATCTTCAAAGTATTCAAAGCGCAAGTGGAACTTCAATTTGGTAAAAAGATCAAGTGCTTTACGAACAGATAA MMWHCKLGHMSEQGLKVLVEQNLLPGLTKVSLPFCKHCITSKQHRLKFNTSSSRSKVILELVNSDVWQSPVTSLGGARYFVSFIDDFSRRCWVYPIKKKADVCSIFKVFKAQVELQFGKKIKCFTNR Homology
BLAST of Cmc05g0138891 vs. NCBI nr
Match: TYK16527.1 (hypothetical protein E5676_scaffold21G003420 [Cucumis melo var. makuwa]) HSP 1 Score: 223.0 bits (567), Expect = 1.4e-54 Identity = 105/123 (85.37%), Postives = 113/123 (91.87%), Query Frame = 0
BLAST of Cmc05g0138891 vs. NCBI nr
Match: KAE8718737.1 (hypothetical protein F3Y22_tig00109992pilonHSYRG00051 [Hibiscus syriacus]) HSP 1 Score: 217.2 bits (552), Expect = 7.9e-53 Identity = 101/124 (81.45%), Postives = 113/124 (91.13%), Query Frame = 0
BLAST of Cmc05g0138891 vs. NCBI nr
Match: KAE8688623.1 (hypothetical protein F3Y22_tig00110962pilonHSYRG00058 [Hibiscus syriacus]) HSP 1 Score: 216.9 bits (551), Expect = 1.0e-52 Identity = 100/124 (80.65%), Postives = 113/124 (91.13%), Query Frame = 0
BLAST of Cmc05g0138891 vs. NCBI nr
Match: KAE8670544.1 (hypothetical protein F3Y22_tig00112127pilonHSYRG00101 [Hibiscus syriacus]) HSP 1 Score: 216.9 bits (551), Expect = 1.0e-52 Identity = 99/124 (79.84%), Postives = 113/124 (91.13%), Query Frame = 0
BLAST of Cmc05g0138891 vs. NCBI nr
Match: KAA0044949.1 (hypothetical protein E6C27_scaffold74G002510 [Cucumis melo var. makuwa]) HSP 1 Score: 216.1 bits (549), Expect = 1.8e-52 Identity = 102/123 (82.93%), Postives = 113/123 (91.87%), Query Frame = 0
BLAST of Cmc05g0138891 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 5.6e-25 Identity = 55/122 (45.08%), Postives = 82/122 (67.21%), Query Frame = 0
BLAST of Cmc05g0138891 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 1.2e-19 Identity = 47/120 (39.17%), Postives = 70/120 (58.33%), Query Frame = 0
BLAST of Cmc05g0138891 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 8.1e-16 Identity = 43/123 (34.96%), Postives = 66/123 (53.66%), Query Frame = 0
BLAST of Cmc05g0138891 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 70.9 bits (172), Expect = 1.2e-11 Identity = 47/130 (36.15%), Postives = 71/130 (54.62%), Query Frame = 0
BLAST of Cmc05g0138891 vs. ExPASy Swiss-Prot
Match: P93293 (Uncharacterized mitochondrial protein AtMg00300 OS=Arabidopsis thaliana OX=3702 GN=AtMg00300 PE=4 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 1.0e-10 Identity = 29/73 (39.73%), Postives = 46/73 (63.01%), Query Frame = 0
BLAST of Cmc05g0138891 vs. ExPASy TrEMBL
Match: A0A5D3CXA6 (Uncharacterized protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold21G003420 PE=4 SV=1) HSP 1 Score: 223.0 bits (567), Expect = 7.0e-55 Identity = 105/123 (85.37%), Postives = 113/123 (91.87%), Query Frame = 0
BLAST of Cmc05g0138891 vs. ExPASy TrEMBL
Match: A0A6A3BRT0 (Uncharacterized protein OS=Hibiscus syriacus OX=106335 GN=F3Y22_tig00109992pilonHSYRG00051 PE=4 SV=1) HSP 1 Score: 217.2 bits (552), Expect = 3.8e-53 Identity = 101/124 (81.45%), Postives = 113/124 (91.13%), Query Frame = 0
BLAST of Cmc05g0138891 vs. ExPASy TrEMBL
Match: A0A6A2ZAL9 (Uncharacterized protein OS=Hibiscus syriacus OX=106335 GN=F3Y22_tig00110962pilonHSYRG00058 PE=4 SV=1) HSP 1 Score: 216.9 bits (551), Expect = 5.0e-53 Identity = 100/124 (80.65%), Postives = 113/124 (91.13%), Query Frame = 0
BLAST of Cmc05g0138891 vs. ExPASy TrEMBL
Match: A0A6A2YDU0 (Uncharacterized protein OS=Hibiscus syriacus OX=106335 GN=F3Y22_tig00112127pilonHSYRG00101 PE=3 SV=1) HSP 1 Score: 216.9 bits (551), Expect = 5.0e-53 Identity = 99/124 (79.84%), Postives = 113/124 (91.13%), Query Frame = 0
BLAST of Cmc05g0138891 vs. ExPASy TrEMBL
Match: A0A5A7TUN0 (Uncharacterized protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold74G002510 PE=4 SV=1) HSP 1 Score: 216.1 bits (549), Expect = 8.6e-53 Identity = 102/123 (82.93%), Postives = 113/123 (91.87%), Query Frame = 0
BLAST of Cmc05g0138891 vs. TAIR 10
Match: ATMG00300.1 (Gag-Pol-related retrotransposon family protein ) HSP 1 Score: 67.8 bits (164), Expect = 7.3e-12 Identity = 29/73 (39.73%), Postives = 46/73 (63.01%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|