
Bhi04G000709 (gene) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCATCCTTTTTACAGTCCTTCATCGTCCCAAAGAAGAAGATTGGGGATTCATCGCCAGATCGACCCAACACCTTCGTAATTAGGGTAATTGAAACCCTAATCGTTTCTTTTTCTATGGCGTTGATTTCGAATTTTGTTCCGTGGAGATTGATTTTAGGTTGTGTTACTATGTTAGGTCTTCGATTCGATCTGTATGATCCATATTATGATATTGATGTGAAGGAGGCTTTGAATAGACTCCCCAGGGAGGTTATTGATGCGGGCAATCAGCATTTGAAGCGGGCCATGGACCTTTCCATGAAGCATCAGTACCTTCCTATTGATCTTCAAGTTTTTTCCTACTATAGATGTTTATCTCTTTCTTAG ATGGCATCCTTTTTACAGTCCTTCATCGTCCCAAAGAAGAAGATTGGGGATTCATCGCCAGATCGACCCAACACCTTCGTAATTAGGGTAATTGAAACCCTAATCGTTTCTTTTTCTATGGCGTTGATTTCGAATTTTGTTCCGTGGAGATTGATTTTAGGTTGTGTTACTATGTTAGGTCTTCGATTCGATCTGTATGATCCATATTATGATATTGATGTGAAGGAGGCTTTGAATAGACTCCCCAGGGAGGTTATTGATGCGGGCAATCAGCATTTGAAGCGGGCCATGGACCTTTCCATGAAGCATCAGTACCTTCCTATTGATCTTCAAGTTTTTTCCTACTATAGATGTTTATCTCTTTCTTAG ATGGCATCCTTTTTACAGTCCTTCATCGTCCCAAAGAAGAAGATTGGGGATTCATCGCCAGATCGACCCAACACCTTCGTAATTAGGGTAATTGAAACCCTAATCGTTTCTTTTTCTATGGCGTTGATTTCGAATTTTGTTCCGTGGAGATTGATTTTAGGTTGTGTTACTATGTTAGGTCTTCGATTCGATCTGTATGATCCATATTATGATATTGATGTGAAGGAGGCTTTGAATAGACTCCCCAGGGAGGTTATTGATGCGGGCAATCAGCATTTGAAGCGGGCCATGGACCTTTCCATGAAGCATCAGTACCTTCCTATTGATCTTCAAGTTTTTTCCTACTATAGATGTTTATCTCTTTCTTAG MASFLQSFIVPKKKIGDSSPDRPNTFVIRVIETLIVSFSMALISNFVPWRLILGCVTMLGLRFDLYDPYYDIDVKEALNRLPREVIDAGNQHLKRAMDLSMKHQYLPIDLQVFSYYRCLSLS Homology
BLAST of Bhi04G000709 vs. TAIR 10
Match: AT5G25450.2 (Cytochrome bd ubiquinol oxidase, 14kDa subunit ) HSP 1 Score: 87.8 bits (216), Expect = 6.5e-18 Identity = 41/54 (75.93%), Postives = 48/54 (88.89%), Query Frame = 0
BLAST of Bhi04G000709 vs. TAIR 10
Match: AT4G32470.1 (Cytochrome bd ubiquinol oxidase, 14kDa subunit ) HSP 1 Score: 87.4 bits (215), Expect = 8.5e-18 Identity = 41/53 (77.36%), Postives = 47/53 (88.68%), Query Frame = 0
BLAST of Bhi04G000709 vs. TAIR 10
Match: AT4G32470.2 (Cytochrome bd ubiquinol oxidase, 14kDa subunit ) HSP 1 Score: 87.4 bits (215), Expect = 8.5e-18 Identity = 41/53 (77.36%), Postives = 47/53 (88.68%), Query Frame = 0
BLAST of Bhi04G000709 vs. TAIR 10
Match: AT5G25450.1 (Cytochrome bd ubiquinol oxidase, 14kDa subunit ) HSP 1 Score: 86.3 bits (212), Expect = 1.9e-17 Identity = 40/53 (75.47%), Postives = 47/53 (88.68%), Query Frame = 0
BLAST of Bhi04G000709 vs. ExPASy Swiss-Prot
Match: P48502 (Cytochrome b-c1 complex subunit 7 OS=Solanum tuberosum OX=4113 PE=1 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 9.2e-17 Identity = 43/53 (81.13%), Postives = 46/53 (86.79%), Query Frame = 0
BLAST of Bhi04G000709 vs. ExPASy Swiss-Prot
Match: Q9SUU5 (Cytochrome b-c1 complex subunit 7-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=QCR7-1 PE=1 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 1.2e-16 Identity = 41/53 (77.36%), Postives = 47/53 (88.68%), Query Frame = 0
BLAST of Bhi04G000709 vs. ExPASy Swiss-Prot
Match: F4JWS8 (Cytochrome b-c1 complex subunit 7-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=QCR7-2 PE=1 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.7e-16 Identity = 40/53 (75.47%), Postives = 47/53 (88.68%), Query Frame = 0
BLAST of Bhi04G000709 vs. ExPASy Swiss-Prot
Match: Q9D855 (Cytochrome b-c1 complex subunit 7 OS=Mus musculus OX=10090 GN=Uqcrb PE=1 SV=3) HSP 1 Score: 45.4 bits (106), Expect = 5.2e-04 Identity = 29/75 (38.67%), Postives = 40/75 (53.33%), Query Frame = 0
BLAST of Bhi04G000709 vs. ExPASy Swiss-Prot
Match: Q5RC24 (Cytochrome b-c1 complex subunit 7 OS=Pongo abelii OX=9601 GN=UQCRB PE=3 SV=3) HSP 1 Score: 45.4 bits (106), Expect = 5.2e-04 Identity = 21/39 (53.85%), Postives = 27/39 (69.23%), Query Frame = 0
BLAST of Bhi04G000709 vs. ExPASy TrEMBL
Match: A0A6P5XQS8 (Cytochrome b-c1 complex subunit 7 OS=Durio zibethinus OX=66656 GN=LOC111285391 PE=3 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 6.6e-18 Identity = 58/112 (51.79%), Postives = 69/112 (61.61%), Query Frame = 0
BLAST of Bhi04G000709 vs. ExPASy TrEMBL
Match: A0A6J1ILG6 (Cytochrome b-c1 complex subunit 7 OS=Cucurbita maxima OX=3661 GN=LOC111476673 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 1.9e-17 Identity = 61/112 (54.46%), Postives = 70/112 (62.50%), Query Frame = 0
BLAST of Bhi04G000709 vs. ExPASy TrEMBL
Match: A0A2N9ISI5 (Cytochrome b-c1 complex subunit 7 OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS54985 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 1.9e-17 Identity = 62/112 (55.36%), Postives = 69/112 (61.61%), Query Frame = 0
BLAST of Bhi04G000709 vs. ExPASy TrEMBL
Match: A0A7J8W296 (Cytochrome b-c1 complex subunit 7 OS=Gossypium klotzschianum OX=34286 GN=Goklo_001848 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 1.9e-17 Identity = 45/58 (77.59%), Postives = 53/58 (91.38%), Query Frame = 0
BLAST of Bhi04G000709 vs. ExPASy TrEMBL
Match: A0A6J1FFY7 (Cytochrome b-c1 complex subunit 7 OS=Cucurbita moschata OX=3662 GN=LOC111443697 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 1.9e-17 Identity = 61/112 (54.46%), Postives = 70/112 (62.50%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|