Cp4.1LG19g00370.1 (mRNA) Cucurbita pepo (MU‐CU‐16) v4.1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGATGGGTGGGAGCAAAAGAGGAAGAAAGGAGGTTTTACTCTAAGTTTGTAGTAAGATTGCCTTCAGCCAGTTAGTAACAGATCTGATTCTAAATCCTCTCTTTTAGTGCTGCTAAATAATGAGGTTCTCTAATGTATAAAGCTTGGTTCTCAGGATTTGGATTGGTAAAACAATACTTCCTGACCATTATTGTATATCTTCTGTCATTATAACTTGTGACTTTTCTTGGTTCATTTCGTTGTTATTATCTCAAGTGCTGGTAACTTGTGGCAGCGTCCTTGCTGAAAAGTTGAACTTGAATTATGAGGAAGCTGAGCGGTGGATTGTAAATCTCGTGCGCACGTCAAAGCTTGATGCAAAGCTTGATTCAAAGACAGGAACGGTTATAATGGAAACGAACGAGCCTGACGTGTAAATGGGATGGGTGGGAGCAAAAGAGGAAGAAAGGAGGTTTTACTCTAAGATTTGGATTGGTAAAACAATACTTCCTGACCATTATTGTATATCTTCTGTCATTATAACTTGTGACTTTTCTTGGTTCATTTCGTTGTTATTATCTCAAGTGCTGGTAACTTGTGGCAGCGTCCTTGCTGAAAAGTTGAACTTGAATTATGAGGAAGCTGAGCGGTGGATTGTAAATCTCGTGCGCACGTCAAAGCTTGATGCAAAGCTTGATTCAAAGACAGGAACGGTTATAATGGAAACGAACGAGCCTGACGTGTAA ATGGGATGGGTGGGAGCAAAAGAGGAAGAAAGGAGGTTTTACTCTAAGATTTGGATTGGTAAAACAATACTTCCTGACCATTATTGTATATCTTCTGTCATTATAACTTGTGACTTTTCTTGGTTCATTTCGTTGTTATTATCTCAAGTGCTGGTAACTTGTGGCAGCGTCCTTGCTGAAAAGTTGAACTTGAATTATGAGGAAGCTGAGCGGTGGATTGTAAATCTCGTGCGCACGTCAAAGCTTGATGCAAAGCTTGATTCAAAGACAGGAACGGTTATAATGGAAACGAACGAGCCTGACGTGTAA MGWVGAKEEERRFYSKIWIGKTILPDHYCISSVIITCDFSWFISLLLSQVLVTCGSVLAEKLNLNYEEAERWIVNLVRTSKLDAKLDSKTGTVIMETNEPDV Homology
BLAST of Cp4.1LG19g00370.1 vs. ExPASy Swiss-Prot
Match: Q9C5Z3 (Eukaryotic translation initiation factor 3 subunit E OS=Arabidopsis thaliana OX=3702 GN=TIF3E1 PE=1 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.6e-14 Identity = 38/46 (82.61%), Postives = 44/46 (95.65%), Query Frame = 0
BLAST of Cp4.1LG19g00370.1 vs. ExPASy Swiss-Prot
Match: A7RWP6 (Eukaryotic translation initiation factor 3 subunit E OS=Nematostella vectensis OX=45351 GN=v1g163572 PE=3 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 9.1e-10 Identity = 31/47 (65.96%), Postives = 37/47 (78.72%), Query Frame = 0
BLAST of Cp4.1LG19g00370.1 vs. ExPASy Swiss-Prot
Match: Q05AY2 (Eukaryotic translation initiation factor 3 subunit E-A OS=Xenopus laevis OX=8355 GN=eif3e-a PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.0e-08 Identity = 28/43 (65.12%), Postives = 36/43 (83.72%), Query Frame = 0
BLAST of Cp4.1LG19g00370.1 vs. ExPASy Swiss-Prot
Match: Q1LUA8 (Eukaryotic translation initiation factor 3 subunit E-B OS=Danio rerio OX=7955 GN=eif3eb PE=3 SV=2) HSP 1 Score: 60.8 bits (146), Expect = 1.0e-08 Identity = 28/43 (65.12%), Postives = 36/43 (83.72%), Query Frame = 0
BLAST of Cp4.1LG19g00370.1 vs. ExPASy Swiss-Prot
Match: Q3B8M3 (Eukaryotic translation initiation factor 3 subunit E-B OS=Xenopus laevis OX=8355 GN=eif3e-b PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.0e-08 Identity = 28/43 (65.12%), Postives = 36/43 (83.72%), Query Frame = 0
BLAST of Cp4.1LG19g00370.1 vs. NCBI nr
Match: XP_023518937.1 (eukaryotic translation initiation factor 3 subunit E [Cucurbita pepo subsp. pepo]) HSP 1 Score: 93.2 bits (230), Expect = 1.15e-19 Identity = 47/47 (100.00%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Cp4.1LG19g00370.1 vs. NCBI nr
Match: KAG7027648.1 (Eukaryotic translation initiation factor 3 subunit E, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 92.4 bits (228), Expect = 2.19e-19 Identity = 46/47 (97.87%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Cp4.1LG19g00370.1 vs. NCBI nr
Match: XP_022966317.1 (eukaryotic translation initiation factor 3 subunit E [Cucurbita maxima]) HSP 1 Score: 92.4 bits (228), Expect = 2.19e-19 Identity = 46/47 (97.87%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Cp4.1LG19g00370.1 vs. NCBI nr
Match: KAG6595686.1 (Eukaryotic translation initiation factor 3 subunit E, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 92.4 bits (228), Expect = 2.84e-19 Identity = 46/47 (97.87%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Cp4.1LG19g00370.1 vs. NCBI nr
Match: XP_022925104.1 (eukaryotic translation initiation factor 3 subunit E-like [Cucurbita moschata]) HSP 1 Score: 89.4 bits (220), Expect = 2.84e-18 Identity = 44/47 (93.62%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Cp4.1LG19g00370.1 vs. ExPASy TrEMBL
Match: A0A6J1HMM9 (Eukaryotic translation initiation factor 3 subunit E OS=Cucurbita maxima OX=3661 GN=LOC111466010 PE=3 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 1.06e-19 Identity = 46/47 (97.87%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Cp4.1LG19g00370.1 vs. ExPASy TrEMBL
Match: A0A6J1EB55 (Eukaryotic translation initiation factor 3 subunit E OS=Cucurbita moschata OX=3662 GN=LOC111432445 PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 1.38e-18 Identity = 44/47 (93.62%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of Cp4.1LG19g00370.1 vs. ExPASy TrEMBL
Match: A0A6J1EKJ5 (Eukaryotic translation initiation factor 3 subunit E OS=Cucurbita moschata OX=3662 GN=LOC111435512 PE=3 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 9.33e-18 Identity = 43/47 (91.49%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of Cp4.1LG19g00370.1 vs. ExPASy TrEMBL
Match: A0A199UAE0 (PCI domain-containing protein OS=Manihot esculenta OX=3983 GN=MANES_S071900 PE=4 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.45e-17 Identity = 38/46 (82.61%), Postives = 44/46 (95.65%), Query Frame = 0
BLAST of Cp4.1LG19g00370.1 vs. ExPASy TrEMBL
Match: A0A2P5AQU8 (Eukaryotic translation initiation factor 3 subunit E OS=Trema orientale OX=63057 GN=TorRG33x02_343960 PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 4.50e-17 Identity = 40/46 (86.96%), Postives = 44/46 (95.65%), Query Frame = 0
BLAST of Cp4.1LG19g00370.1 vs. TAIR 10
Match: AT3G57290.1 (eukaryotic translation initiation factor 3E ) HSP 1 Score: 80.1 bits (196), Expect = 1.1e-15 Identity = 38/46 (82.61%), Postives = 44/46 (95.65%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|