Tan0020528.1 (mRNA) Snake gourd v1
Overview
Sequences
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AAAAAAGAGAAGAAAAAAAAATTATTTTATTTATTCTCTAAACTTGAAAGAGCATGTGACCAAGTTAGCTATAAATAAAGCTACTTAACGAAGAATAAAGCATCGATCTCTCATTCCAGTTTTAACGAATAGATAGCAATACCAAGATGAATAGTAAGTAAAAAAAATCAGATTATATTTTTGTTGAGTTTTTTTTTTCTTAATTTTTGGTTGAACATGTATATATTCTATATTATATTATTTTTTTGCATGATTTCAGGAAAATCATGGCCGGAACTGGAATTCGTGGATGCTGTGACGGTAATCAATTACATAAAGAAAACAGATCCTGAGTTGAATATAGTTATACTGTTAAATGGAAGTCCAGTGACAAAAGACTTGAGGTTGGATCGAGTTCGACTTTTTGTTAACATCAATAATATCGTGATGAATGTTCCTACCACTGGTTGAAATATCAAAAATATATGTATGTACTGATCTTACCAGAGGTTAAAATGTCTTAAATGCATATGTTTAGATATAATATTTAAATAAAGTAGAATCTATTTCTACTACTTTAC AAAAAAGAGAAGAAAAAAAAATTATTTTATTTATTCTCTAAACTTGAAAGAGCATGTGACCAAGTTAGCTATAAATAAAGCTACTTAACGAAGAATAAAGCATCGATCTCTCATTCCAGTTTTAACGAATAGATAGCAATACCAAGATGAATAGAAAATCATGGCCGGAACTGGAATTCGTGGATGCTGTGACGGTAATCAATTACATAAAGAAAACAGATCCTGAGTTGAATATAGTTATACTGTTAAATGGAAGTCCAGTGACAAAAGACTTGAGGTTGGATCGAGTTCGACTTTTTGTTAACATCAATAATATCGTGATGAATGTTCCTACCACTGGTTGAAATATCAAAAATATATGTATGTACTGATCTTACCAGAGGTTAAAATGTCTTAAATGCATATGTTTAGATATAATATTTAAATAAAGTAGAATCTATTTCTACTACTTTAC ATGAATAGAAAATCATGGCCGGAACTGGAATTCGTGGATGCTGTGACGGTAATCAATTACATAAAGAAAACAGATCCTGAGTTGAATATAGTTATACTGTTAAATGGAAGTCCAGTGACAAAAGACTTGAGGTTGGATCGAGTTCGACTTTTTGTTAACATCAATAATATCGTGATGAATGTTCCTACCACTGGTTGA MNRKSWPELEFVDAVTVINYIKKTDPELNIVILLNGSPVTKDLRLDRVRLFVNINNIVMNVPTTG Homology
BLAST of Tan0020528.1 vs. ExPASy Swiss-Prot
Match: P16231 (Wound-induced proteinase inhibitor 1 OS=Solanum peruvianum OX=4082 PE=3 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 2.9e-09 Identity = 34/61 (55.74%), Postives = 42/61 (68.85%), Query Frame = 0
BLAST of Tan0020528.1 vs. ExPASy Swiss-Prot
Match: Q03199 (Proteinase inhibitor I-B OS=Nicotiana tabacum OX=4097 GN=TIMPA PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 3.2e-08 Identity = 29/66 (43.94%), Postives = 44/66 (66.67%), Query Frame = 0
BLAST of Tan0020528.1 vs. ExPASy Swiss-Prot
Match: Q03198 (Proteinase inhibitor I-A OS=Nicotiana tabacum OX=4097 GN=TIMPB PE=2 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 5.4e-08 Identity = 28/66 (42.42%), Postives = 43/66 (65.15%), Query Frame = 0
BLAST of Tan0020528.1 vs. ExPASy Swiss-Prot
Match: Q02214 (Trypsin inhibitor 1 OS=Nicotiana sylvestris OX=4096 PE=2 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 5.4e-08 Identity = 30/64 (46.88%), Postives = 43/64 (67.19%), Query Frame = 0
BLAST of Tan0020528.1 vs. ExPASy Swiss-Prot
Match: P20076 (Ethylene-responsive proteinase inhibitor 1 OS=Solanum lycopersicum OX=4081 PE=3 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 7.1e-08 Identity = 31/66 (46.97%), Postives = 43/66 (65.15%), Query Frame = 0
BLAST of Tan0020528.1 vs. NCBI nr
Match: KAG6571807.1 (hypothetical protein SDJN03_28535, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 75.5 bits (184), Expect = 1.9e-10 Identity = 39/62 (62.90%), Postives = 44/62 (70.97%), Query Frame = 0
BLAST of Tan0020528.1 vs. NCBI nr
Match: KGN60477.1 (hypothetical protein Csa_001998 [Cucumis sativus]) HSP 1 Score: 74.7 bits (182), Expect = 3.3e-10 Identity = 38/62 (61.29%), Postives = 44/62 (70.97%), Query Frame = 0
BLAST of Tan0020528.1 vs. NCBI nr
Match: XP_011654473.1 (inhibitor of trypsin and hageman factor [Cucumis sativus] >KGN49621.1 hypothetical protein Csa_018430 [Cucumis sativus]) HSP 1 Score: 70.1 bits (170), Expect = 8.0e-09 Identity = 32/63 (50.79%), Postives = 48/63 (76.19%), Query Frame = 0
BLAST of Tan0020528.1 vs. NCBI nr
Match: KGN60478.1 (hypothetical protein Csa_001396 [Cucumis sativus]) HSP 1 Score: 66.2 bits (160), Expect = 1.2e-07 Identity = 34/64 (53.12%), Postives = 42/64 (65.62%), Query Frame = 0
BLAST of Tan0020528.1 vs. NCBI nr
Match: CAF3779213.1 (unnamed protein product [Rotaria sordida]) HSP 1 Score: 65.5 bits (158), Expect = 2.0e-07 Identity = 32/65 (49.23%), Postives = 44/65 (67.69%), Query Frame = 0
BLAST of Tan0020528.1 vs. ExPASy TrEMBL
Match: A0A0A0LIF6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G914570 PE=3 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 1.6e-10 Identity = 38/62 (61.29%), Postives = 44/62 (70.97%), Query Frame = 0
BLAST of Tan0020528.1 vs. ExPASy TrEMBL
Match: A0A0A0KPI0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G027950 PE=3 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 3.9e-09 Identity = 32/63 (50.79%), Postives = 48/63 (76.19%), Query Frame = 0
BLAST of Tan0020528.1 vs. ExPASy TrEMBL
Match: A0A0A0LFD4 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G914580 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 5.6e-08 Identity = 34/64 (53.12%), Postives = 42/64 (65.62%), Query Frame = 0
BLAST of Tan0020528.1 vs. ExPASy TrEMBL
Match: A0A1S3YJI6 (trypsin inhibitor 1-like OS=Nicotiana tabacum OX=4097 GN=LOC107776717 PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 1.6e-07 Identity = 34/66 (51.52%), Postives = 47/66 (71.21%), Query Frame = 0
BLAST of Tan0020528.1 vs. ExPASy TrEMBL
Match: A0A6N2AU12 (Uncharacterized protein OS=Solanum chilense OX=4083 GN=EJD97_023458 PE=3 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 2.1e-07 Identity = 34/61 (55.74%), Postives = 43/61 (70.49%), Query Frame = 0
BLAST of Tan0020528.1 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 57.8 bits (138), Expect = 3.8e-09 Identity = 27/63 (42.86%), Postives = 40/63 (63.49%), Query Frame = 0
BLAST of Tan0020528.1 vs. TAIR 10
Match: AT2G38900.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 45.4 bits (106), Expect = 2.0e-05 Identity = 24/65 (36.92%), Postives = 39/65 (60.00%), Query Frame = 0
BLAST of Tan0020528.1 vs. TAIR 10
Match: AT2G38900.2 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 45.4 bits (106), Expect = 2.0e-05 Identity = 24/65 (36.92%), Postives = 39/65 (60.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Snake gourd (anguina) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following five_prime_UTR feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|