![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Spg023955.1 (mRNA) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: five_prime_UTRCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AAAGAGATCAACTTAGAATTAGGCCTCAAACGAAACGAAAGCTTCCAATTTTCTTCAGTTTCAATGTCTTGGGGCTCTTGGTTACGACCCGAACACATCTTCCTCACTACTTCTCTCGGCGCTTATCTCGACCGTACAACACATCAACATCCTCTTCTCTTCTTCCAACTCTTCTTCTTCCAATTATACTCATTGTTAATCTCTTTCTGCTTCAGGCAAAATACTGCTGACGCTTCTTGATGGACGTGATTTCATCGGCATCATGCGTTCCTTCGACCACCACGGTATCGCTATCTATCTATCTATCTATCTATCTATAGGATACAATCTTTGTATTAACCAATCACTCTATCAGGTAACATTGTTCTTCAGGATGCATTTGAAAGAATTATTGTTGGCAATCTCTATTGCGATAACCGCAAGGGACTCGTCTTGACTCGAGCCGAGAATGCGATTCTAGTTGGAGAGATGGTAATATATAACAACAATCTCATTTCTTTCTCTTTTTCATTCGAATCTTAGTTTTTCTTTCACTTGTATCATTATTCAGGACTCCAGATTCCCAGAACTTCCTCCTGATATGACTAGCGTCTCACTGCCTGAGATTTTAACTGTAGGTAAACTAAACTAAACTACTTCCCTTTTAAATGGGGCTTTGAGGGAGCCCAATCTTGTAAAGAATCATGTCCAATTGTCCATGCAGGCTCAGAAAGCAGAAATGGACTCATCAAGGCTTAAAAGAAGCTTCAAGAAATGGATGGAGGACTTCCTTGACGATTTTTGAAATGTATCTTCAGTCCACTAGTGATTTTCTGTTTTTTGTTTGGATAGTTGAAAACAATTTGTTAGTTCCCTGTTTGCTAGTTATATTCTATTGTCAATGAATGGAAAA ATGTCTTGGGGCTCTTGGTTACGACCCGAACACATCTTCCTCACTACTTCTCTCGGCGCTTATCTCGACCGCAAAATACTGCTGACGCTTCTTGATGGACGTGATTTCATCGGCATCATGCGTTCCTTCGACCACCACGGTAACATTGTTCTTCAGGATGCATTTGAAAGAATTATTGTTGGCAATCTCTATTGCGATAACCGCAAGGGACTCGTCTTGACTCGAGCCGAGAATGCGATTCTAGTTGGAGAGATGGACTCCAGATTCCCAGAACTTCCTCCTGATATGACTAGCGTCTCACTGCCTGAGATTTTAACTGCTCAGAAAGCAGAAATGGACTCATCAAGGCTTAAAAGAAGCTTCAAGAAATGGATGGAGGACTTCCTTGACGATTTTTGA ATGTCTTGGGGCTCTTGGTTACGACCCGAACACATCTTCCTCACTACTTCTCTCGGCGCTTATCTCGACCGCAAAATACTGCTGACGCTTCTTGATGGACGTGATTTCATCGGCATCATGCGTTCCTTCGACCACCACGGTAACATTGTTCTTCAGGATGCATTTGAAAGAATTATTGTTGGCAATCTCTATTGCGATAACCGCAAGGGACTCGTCTTGACTCGAGCCGAGAATGCGATTCTAGTTGGAGAGATGGACTCCAGATTCCCAGAACTTCCTCCTGATATGACTAGCGTCTCACTGCCTGAGATTTTAACTGCTCAGAAAGCAGAAATGGACTCATCAAGGCTTAAAAGAAGCTTCAAGAAATGGATGGAGGACTTCCTTGACGATTTTTGA MSWGSWLRPEHIFLTTSLGAYLDRKILLTLLDGRDFIGIMRSFDHHGNIVLQDAFERIIVGNLYCDNRKGLVLTRAENAILVGEMDSRFPELPPDMTSVSLPEILTAQKAEMDSSRLKRSFKKWMEDFLDDF Homology
BLAST of Spg023955.1 vs. NCBI nr
Match: XP_023527037.1 (sm-like protein LSM1B isoform X2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 161.4 bits (407), Expect = 5.4e-36 Identity = 74/122 (60.66%), Postives = 95/122 (77.87%), Query Frame = 0
BLAST of Spg023955.1 vs. NCBI nr
Match: XP_022955856.1 (sm-like protein LSM1B [Cucurbita moschata]) HSP 1 Score: 156.4 bits (394), Expect = 1.7e-34 Identity = 72/121 (59.50%), Postives = 94/121 (77.69%), Query Frame = 0
BLAST of Spg023955.1 vs. NCBI nr
Match: XP_022980750.1 (sm-like protein LSM1B [Cucurbita maxima]) HSP 1 Score: 151.4 bits (381), Expect = 5.6e-33 Identity = 70/121 (57.85%), Postives = 91/121 (75.21%), Query Frame = 0
BLAST of Spg023955.1 vs. NCBI nr
Match: XP_039018543.1 (sm-like protein LSM1B [Hibiscus syriacus] >KAE8687572.1 U6 snRNA-associated Sm-like protein LSm1 [Hibiscus syriacus]) HSP 1 Score: 142.5 bits (358), Expect = 2.6e-30 Identity = 71/126 (56.35%), Postives = 91/126 (72.22%), Query Frame = 0
BLAST of Spg023955.1 vs. NCBI nr
Match: KAF8388708.1 (hypothetical protein HHK36_025388 [Tetracentron sinense]) HSP 1 Score: 142.5 bits (358), Expect = 2.6e-30 Identity = 73/126 (57.94%), Postives = 91/126 (72.22%), Query Frame = 0
BLAST of Spg023955.1 vs. ExPASy Swiss-Prot
Match: Q945P8 (Sm-like protein LSM1A OS=Arabidopsis thaliana OX=3702 GN=LSM1A PE=1 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 3.0e-29 Identity = 65/126 (51.59%), Postives = 85/126 (67.46%), Query Frame = 0
BLAST of Spg023955.1 vs. ExPASy Swiss-Prot
Match: Q8LFL8 (Sm-like protein LSM1B OS=Arabidopsis thaliana OX=3702 GN=LSM1B PE=1 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 3.0e-29 Identity = 66/126 (52.38%), Postives = 85/126 (67.46%), Query Frame = 0
BLAST of Spg023955.1 vs. ExPASy Swiss-Prot
Match: Q54W83 (Probable U6 snRNA-associated Sm-like protein LSm1 OS=Dictyostelium discoideum OX=44689 GN=lsm1 PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.4e-15 Identity = 44/110 (40.00%), Postives = 63/110 (57.27%), Query Frame = 0
BLAST of Spg023955.1 vs. ExPASy Swiss-Prot
Match: P87173 (U6 snRNA-associated Sm-like protein LSm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm1 PE=1 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 5.1e-13 Identity = 33/70 (47.14%), Postives = 49/70 (70.00%), Query Frame = 0
BLAST of Spg023955.1 vs. ExPASy Swiss-Prot
Match: Q5E9Z8 (U6 snRNA-associated Sm-like protein LSm1 OS=Bos taurus OX=9913 GN=LSM1 PE=2 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 1.1e-12 Identity = 41/100 (41.00%), Postives = 56/100 (56.00%), Query Frame = 0
BLAST of Spg023955.1 vs. ExPASy TrEMBL
Match: A0A6J1GV01 (sm-like protein LSM1B OS=Cucurbita moschata OX=3662 GN=LOC111457720 PE=3 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 8.4e-35 Identity = 72/121 (59.50%), Postives = 94/121 (77.69%), Query Frame = 0
BLAST of Spg023955.1 vs. ExPASy TrEMBL
Match: A0A6J1IXE4 (sm-like protein LSM1B OS=Cucurbita maxima OX=3661 GN=LOC111480024 PE=3 SV=1) HSP 1 Score: 151.4 bits (381), Expect = 2.7e-33 Identity = 70/121 (57.85%), Postives = 91/121 (75.21%), Query Frame = 0
BLAST of Spg023955.1 vs. ExPASy TrEMBL
Match: A0A6A2Z8Z4 (U6 snRNA-associated Sm-like protein LSm1 OS=Hibiscus syriacus OX=106335 GN=LSM1 PE=3 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 1.3e-30 Identity = 71/126 (56.35%), Postives = 91/126 (72.22%), Query Frame = 0
BLAST of Spg023955.1 vs. ExPASy TrEMBL
Match: A0A5C7HX26 (U6 snRNA-associated Sm-like protein LSm1 OS=Acer yangbiense OX=1000413 GN=LSM1 PE=3 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 2.1e-30 Identity = 72/126 (57.14%), Postives = 90/126 (71.43%), Query Frame = 0
BLAST of Spg023955.1 vs. ExPASy TrEMBL
Match: A0A022Q0J9 (U6 snRNA-associated Sm-like protein LSm1 OS=Erythranthe guttata OX=4155 GN=LSM1 PE=3 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 2.1e-30 Identity = 70/126 (55.56%), Postives = 88/126 (69.84%), Query Frame = 0
BLAST of Spg023955.1 vs. TAIR 10
Match: AT1G19120.1 (Small nuclear ribonucleoprotein family protein ) HSP 1 Score: 129.4 bits (324), Expect = 2.1e-30 Identity = 65/126 (51.59%), Postives = 85/126 (67.46%), Query Frame = 0
BLAST of Spg023955.1 vs. TAIR 10
Match: AT3G14080.1 (Small nuclear ribonucleoprotein family protein ) HSP 1 Score: 129.4 bits (324), Expect = 2.1e-30 Identity = 66/126 (52.38%), Postives = 85/126 (67.46%), Query Frame = 0
BLAST of Spg023955.1 vs. TAIR 10
Match: AT3G14080.2 (Small nuclear ribonucleoprotein family protein ) HSP 1 Score: 129.4 bits (324), Expect = 2.1e-30 Identity = 66/126 (52.38%), Postives = 85/126 (67.46%), Query Frame = 0
BLAST of Spg023955.1 vs. TAIR 10
Match: AT1G65700.1 (Small nuclear ribonucleoprotein family protein ) HSP 1 Score: 48.1 bits (113), Expect = 6.2e-06 Identity = 23/73 (31.51%), Postives = 40/73 (54.79%), Query Frame = 0
BLAST of Spg023955.1 vs. TAIR 10
Match: AT1G65700.2 (Small nuclear ribonucleoprotein family protein ) HSP 1 Score: 48.1 bits (113), Expect = 6.2e-06 Identity = 23/73 (31.51%), Postives = 40/73 (54.79%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following five_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|