![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Spg009787.1 (mRNA) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTCGGACGTGTGGTCGACGCGTTGGGAGTACCTATTGATGGAAGAGGGGCTCTAAGCGATCACGAGCGAAGACGTGTTGAAGTGAAAGCCCCTGGGATTATTGAACGTAAATCTGTGCACGAGCCTATGCAAATAGGGTTAAAAGCGGTAGATAGCCTGGTTCCTATAGGTCGTGGCCAACGAGAACTTATAATCGATGACCGACAAACTGGAAAAACAGCTATAGCTATCGATACCATGTTAAACCAAAAGCAAATGAACTCAAGGGCTAGAAGTTCAAAATTTGGCTTGGTTTTAGAATTGTTATTGAAAGGTAGGTAA ATGCTCGGACGTGTGGTCGACGCGTTGGGAGTACCTATTGATGGAAGAGGGGCTCTAAGCGATCACGAGCGAAGACGTGTTGAAGTGAAAGCCCCTGGGATTATTGAACGTAAATCTGTGCACGAGCCTATGCAAATAGGGTTAAAAGCGGTAGATAGCCTGGTTCCTATAGGTCGTGGCCAACGAGAACTTATAATCGATGACCGACAAACTGGAAAAACAGCTATAGCTATCGATACCATGTTAAACCAAAAGCAAATGAACTCAAGGGCTAGAAGTTCAAAATTTGGCTTGGTTTTAGAATTGTTATTGAAAGGTAGGTAA ATGCTCGGACGTGTGGTCGACGCGTTGGGAGTACCTATTGATGGAAGAGGGGCTCTAAGCGATCACGAGCGAAGACGTGTTGAAGTGAAAGCCCCTGGGATTATTGAACGTAAATCTGTGCACGAGCCTATGCAAATAGGGTTAAAAGCGGTAGATAGCCTGGTTCCTATAGGTCGTGGCCAACGAGAACTTATAATCGATGACCGACAAACTGGAAAAACAGCTATAGCTATCGATACCATGTTAAACCAAAAGCAAATGAACTCAAGGGCTAGAAGTTCAAAATTTGGCTTGGTTTTAGAATTGTTATTGAAAGGTAGGTAA MLGRVVDALGVPIDGRGALSDHERRRVEVKAPGIIERKSVHEPMQIGLKAVDSLVPIGRGQRELIIDDRQTGKTAIAIDTMLNQKQMNSRARSSKFGLVLELLLKGR Homology
BLAST of Spg009787.1 vs. NCBI nr
Match: AAV68290.1 (F1-ATPase alpha subunit, partial [Pilostyles aethiopica]) HSP 1 Score: 174.9 bits (442), Expect = 3.8e-40 Identity = 89/93 (95.70%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Spg009787.1 vs. NCBI nr
Match: YP_004849346.1 (ATPase subunit 1 [Cucumis sativus] >ADZ10773.1 ATPase subunit 1 [Cucumis sativus]) HSP 1 Score: 174.9 bits (442), Expect = 3.8e-40 Identity = 89/93 (95.70%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Spg009787.1 vs. NCBI nr
Match: QXE45581.1 (ATPase subunit 1 [Prosopis glandulosa]) HSP 1 Score: 174.9 bits (442), Expect = 3.8e-40 Identity = 90/98 (91.84%), Postives = 91/98 (92.86%), Query Frame = 0
BLAST of Spg009787.1 vs. NCBI nr
Match: ARG44482.1 (ATP synthase subunit alpha, partial [Anadenanthera colubrina var. cebil]) HSP 1 Score: 174.5 bits (441), Expect = 5.0e-40 Identity = 89/93 (95.70%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Spg009787.1 vs. NCBI nr
Match: AUD38685.1 (ATP synthase F1 subunit 1 [Anthospermum spathulatum]) HSP 1 Score: 174.5 bits (441), Expect = 5.0e-40 Identity = 89/93 (95.70%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Spg009787.1 vs. ExPASy Swiss-Prot
Match: P05493 (ATP synthase subunit alpha, mitochondrial OS=Pisum sativum OX=3888 GN=ATPA PE=3 SV=2) HSP 1 Score: 174.5 bits (441), Expect = 6.5e-43 Identity = 89/93 (95.70%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Spg009787.1 vs. ExPASy Swiss-Prot
Match: P24459 (ATP synthase subunit alpha, mitochondrial OS=Phaseolus vulgaris OX=3885 GN=ATPA PE=3 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 6.5e-43 Identity = 89/93 (95.70%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Spg009787.1 vs. ExPASy Swiss-Prot
Match: Q01915 (ATP synthase subunit alpha, mitochondrial OS=Glycine max OX=3847 GN=ATPA PE=3 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 6.5e-43 Identity = 89/93 (95.70%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Spg009787.1 vs. ExPASy Swiss-Prot
Match: P18260 (ATP synthase subunit alpha, mitochondrial OS=Helianthus annuus OX=4232 GN=ATPA PE=3 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 1.5e-42 Identity = 88/93 (94.62%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Spg009787.1 vs. ExPASy Swiss-Prot
Match: Q06735 (ATP synthase subunit alpha, mitochondrial OS=Beta vulgaris OX=161934 GN=ATPA PE=3 SV=1) HSP 1 Score: 172.2 bits (435), Expect = 3.2e-42 Identity = 87/93 (93.55%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Spg009787.1 vs. ExPASy TrEMBL
Match: G3EIZ8 (ATP synthase subunit alpha OS=Cucumis sativus OX=3659 GN=atp1 PE=3 SV=1) HSP 1 Score: 174.9 bits (442), Expect = 1.8e-40 Identity = 89/93 (95.70%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Spg009787.1 vs. ExPASy TrEMBL
Match: Q5QCG2 (ATP synthase subunit alpha (Fragment) OS=Pilostyles aethiopica OX=301899 GN=atp1 PE=3 SV=1) HSP 1 Score: 174.9 bits (442), Expect = 1.8e-40 Identity = 89/93 (95.70%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Spg009787.1 vs. ExPASy TrEMBL
Match: Q9XPB2 (ATP synthase subunit alpha OS=Vigna radiata var. radiata OX=3916 GN=atp alpha PE=3 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 2.4e-40 Identity = 89/93 (95.70%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Spg009787.1 vs. ExPASy TrEMBL
Match: S4SKS9 (ATP synthase subunit alpha OS=Gossypium hirsutum OX=3635 GN=atp1 PE=3 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 2.4e-40 Identity = 89/93 (95.70%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Spg009787.1 vs. ExPASy TrEMBL
Match: M1G679 (ATP synthase subunit alpha (Fragment) OS=Gossypium hirsutum OX=3635 GN=atp1 PE=2 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 2.4e-40 Identity = 89/93 (95.70%), Postives = 90/93 (96.77%), Query Frame = 0
BLAST of Spg009787.1 vs. TAIR 10
Match: AT2G07698.1 (ATPase, F1 complex, alpha subunit protein ) HSP 1 Score: 166.4 bits (420), Expect = 1.3e-41 Identity = 82/93 (88.17%), Postives = 89/93 (95.70%), Query Frame = 0
BLAST of Spg009787.1 vs. TAIR 10
Match: ATMG01190.1 (ATP synthase subunit 1 ) HSP 1 Score: 163.7 bits (413), Expect = 8.2e-41 Identity = 81/93 (87.10%), Postives = 88/93 (94.62%), Query Frame = 0
BLAST of Spg009787.1 vs. TAIR 10
Match: ATCG00120.1 (ATP synthase subunit alpha ) HSP 1 Score: 120.2 bits (300), Expect = 1.0e-27 Identity = 58/87 (66.67%), Postives = 71/87 (81.61%), Query Frame = 0
BLAST of Spg009787.1 vs. TAIR 10
Match: AT5G08670.1 (ATP synthase alpha/beta family protein ) HSP 1 Score: 50.1 bits (118), Expect = 1.3e-06 Identity = 25/82 (30.49%), Postives = 42/82 (51.22%), Query Frame = 0
BLAST of Spg009787.1 vs. TAIR 10
Match: AT5G08680.1 (ATP synthase alpha/beta family protein ) HSP 1 Score: 50.1 bits (118), Expect = 1.3e-06 Identity = 25/82 (30.49%), Postives = 42/82 (51.22%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|