PI0012168.1 (mRNA) Melon (PI 482460) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGACTTCAGACTCCTTATTCAATGGCACAACGAAGGGTAAAGCTTAGTCTTCTTAAACGGAGAATGAAAGAGAACTCTGCACCTAGAATGTGAAAGGGAACTACTTAAGTCAAATTCTTTGAACCTCAACATCTAATCCCGCCGACCCTACATTCTTTGCGAGGGTCTTGACCATAGGCATATAACCATTTTACATATCAAACAAACTGGAACATCCTTCTTTTGGATCATTTGTTTCTTTCAGTTTTTCAAGTCGTTGGTGGGTAGTAGTAATTGACTTGAATGGTTAATTAATGATTGTTTGAATTTGATTGTTAACATAGAAAAGTAGCAAAAGAGTTCTCTTTGTGAGGAATTTAATCTGGAAAGTTGTTGGTTTTGCCCCCATAAAAGAAGAGAATCACTAAGCTTCTTAAAGTTGTAAAGGACAAGAGAGCACTAAAAGTGACTAAGAGAAAGTTGAAAACTCACAACAGAGGTAAGAAGAAGAAAGAAGAGACGTCCAACCTTACGGCTTATTTGTAAGTTTTTTAACAAGTTTGCATCATACAACAAAACATCTTAATTTTCTGAGCGATTGGAAAAATTGGTGATCTGTTATGCTAGAGTTCGCTTGGAAGAGAAAGATATGGCAGACAAGATGTTCATCATGGAGAATGTGGATGGAGCACTTTGCTGCCTTAAACGCTTACGAAGCTTAAGGAACTCTTTTGCCTCACCTTCGTCAAACATGCTCGAATTTCTAATTGATAACTATTTATATTTAGTTTTATATACAAAAATCCATTTGTTTTGTTTCTCTAAAGAATTTTCTGTATGATGTTGCATTGGGTATCTTCTTATAGGTGATGTGAACAAAGTACAAGCAATAAAAAGAATAGTTGA ATGGAGACTTCAGACTCCTTATTCAATGGCACAACGAAGGGTAAAGCTTATAGCAAAAGAGTTCTCTTTGTGAGGAATTTAATCTGGAAAGTTCTTCTTAAAGTTGTAAAGGACAAGAGAGCACTAAAAGTGACTAAGAGAAAGTTGAAAACTCACAACAGAGGTAAGAAGAAGAAAGAAGAGACGTCCAACCTTACGGCTTATTTTACAAGCAATAAAAAGAATAGTTGA ATGGAGACTTCAGACTCCTTATTCAATGGCACAACGAAGGGTAAAGCTTATAGCAAAAGAGTTCTCTTTGTGAGGAATTTAATCTGGAAAGTTCTTCTTAAAGTTGTAAAGGACAAGAGAGCACTAAAAGTGACTAAGAGAAAGTTGAAAACTCACAACAGAGGTAAGAAGAAGAAAGAAGAGACGTCCAACCTTACGGCTTATTTTACAAGCAATAAAAAGAATAGTTGA METSDSLFNGTTKGKAYSKRVLFVRNLIWKVLLKVVKDKRALKVTKRKLKTHNRGKKKKEETSNLTAYFTSNKKNS Homology
BLAST of PI0012168.1 vs. ExPASy Swiss-Prot
Match: Q9M352 (60S ribosomal protein L36-2 OS=Arabidopsis thaliana OX=3702 GN=RPL36B PE=3 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 5.9e-06 Identity = 36/65 (55.38%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of PI0012168.1 vs. ExPASy Swiss-Prot
Match: Q9LZ57 (60S ribosomal protein L36-3 OS=Arabidopsis thaliana OX=3702 GN=RPL36C PE=3 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 5.9e-06 Identity = 36/65 (55.38%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of PI0012168.1 vs. ExPASy Swiss-Prot
Match: O80929 (60S ribosomal protein L36-1 OS=Arabidopsis thaliana OX=3702 GN=RPL36A PE=3 SV=1) HSP 1 Score: 48.9 bits (115), Expect = 2.9e-05 Identity = 35/65 (53.85%), Postives = 42/65 (64.62%), Query Frame = 0
BLAST of PI0012168.1 vs. ExPASy TrEMBL
Match: A0A6J1IDA3 (60S ribosomal protein L36 OS=Cucurbita maxima OX=3661 GN=LOC111471531 PE=3 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 5.2e-05 Identity = 41/65 (63.08%), Postives = 45/65 (69.23%), Query Frame = 0
BLAST of PI0012168.1 vs. ExPASy TrEMBL
Match: A0A6J1E2F7 (60S ribosomal protein L36 OS=Cucurbita moschata OX=3662 GN=LOC111430179 PE=3 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 5.2e-05 Identity = 41/65 (63.08%), Postives = 45/65 (69.23%), Query Frame = 0
BLAST of PI0012168.1 vs. ExPASy TrEMBL
Match: I1HT92 (60S ribosomal protein L36 OS=Brachypodium distachyon OX=15368 GN=100842116 PE=3 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 6.8e-05 Identity = 40/65 (61.54%), Postives = 45/65 (69.23%), Query Frame = 0
BLAST of PI0012168.1 vs. ExPASy TrEMBL
Match: A0A5N6LFM1 (60S ribosomal protein L36 OS=Mikania micrantha OX=192012 GN=E3N88_43164 PE=3 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 6.8e-05 Identity = 39/65 (60.00%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of PI0012168.1 vs. ExPASy TrEMBL
Match: A0A7N2MG83 (60S ribosomal protein L36 OS=Quercus lobata OX=97700 PE=3 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 6.8e-05 Identity = 41/64 (64.06%), Postives = 43/64 (67.19%), Query Frame = 0
BLAST of PI0012168.1 vs. NCBI nr
Match: XP_038888040.1 (60S ribosomal protein L36-3-like [Benincasa hispida]) HSP 1 Score: 57.4 bits (137), Expect = 6.3e-05 Identity = 37/61 (60.66%), Postives = 42/61 (68.85%), Query Frame = 0
BLAST of PI0012168.1 vs. NCBI nr
Match: XP_023907749.1 (60S ribosomal protein L36-2-like [Quercus suber] >XP_023907757.1 60S ribosomal protein L36-2-like [Quercus suber] >XP_023914879.1 60S ribosomal protein L36-2-like [Quercus suber] >XP_023914880.1 60S ribosomal protein L36-2-like [Quercus suber]) HSP 1 Score: 57.0 bits (136), Expect = 8.2e-05 Identity = 41/65 (63.08%), Postives = 44/65 (67.69%), Query Frame = 0
BLAST of PI0012168.1 vs. NCBI nr
Match: KAG6579388.1 (60S ribosomal protein L36-2, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 56.6 bits (135), Expect = 1.1e-04 Identity = 41/65 (63.08%), Postives = 45/65 (69.23%), Query Frame = 0
BLAST of PI0012168.1 vs. NCBI nr
Match: XP_011008474.1 (PREDICTED: 60S ribosomal protein L36-2-like isoform X2 [Populus euphratica]) HSP 1 Score: 56.6 bits (135), Expect = 1.1e-04 Identity = 41/65 (63.08%), Postives = 45/65 (69.23%), Query Frame = 0
BLAST of PI0012168.1 vs. NCBI nr
Match: XP_011008473.1 (PREDICTED: 60S ribosomal protein L36-1-like isoform X1 [Populus euphratica]) HSP 1 Score: 56.6 bits (135), Expect = 1.1e-04 Identity = 41/65 (63.08%), Postives = 45/65 (69.23%), Query Frame = 0
BLAST of PI0012168.1 vs. TAIR 10
Match: AT3G53740.2 (Ribosomal protein L36e family protein ) HSP 1 Score: 51.2 bits (121), Expect = 4.2e-07 Identity = 36/65 (55.38%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of PI0012168.1 vs. TAIR 10
Match: AT3G53740.3 (Ribosomal protein L36e family protein ) HSP 1 Score: 51.2 bits (121), Expect = 4.2e-07 Identity = 36/65 (55.38%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of PI0012168.1 vs. TAIR 10
Match: AT3G53740.4 (Ribosomal protein L36e family protein ) HSP 1 Score: 51.2 bits (121), Expect = 4.2e-07 Identity = 36/65 (55.38%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of PI0012168.1 vs. TAIR 10
Match: AT5G02450.1 (Ribosomal protein L36e family protein ) HSP 1 Score: 51.2 bits (121), Expect = 4.2e-07 Identity = 36/65 (55.38%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of PI0012168.1 vs. TAIR 10
Match: AT2G37600.1 (Ribosomal protein L36e family protein ) HSP 1 Score: 48.9 bits (115), Expect = 2.1e-06 Identity = 35/65 (53.85%), Postives = 42/65 (64.62%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (PI 482460) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|