MELO3C029332.1 (mRNA) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TCGTTAGCTTAGTGGGAGTTGTTGGAAGTACGGGGGAAGGGGACATCACTACTTTCAGCCATGCTTGGAGAACTTTCACCAATGCCTAGGAATGCAGATGCAAATGCTACTGTTTTTATTCAAGGAGTTGTTACTTATGTTCCACAAGTTTCATGGATTTTTAATGCAACAGTAAGTATCAATATTATACAATAATTAATTACTTCTTGACTATTACTTTACTTTAATTGCATTGCTTATGCATTTTTAATCAATTTATCAATGTGTGATAATATTTTATTTGGAGCTACATTTGATTATGCCAAATATGAAAAGATAATCGATATAACTTCATTTTTTCATACCTAGGGCTTGAAGAATCCTCGAGATAGTGGCAGTGCTTGTTGAATTTTTATGAAA TCGTTAGCTTAGTGGGAGTTGTTGGAAGTACGGGGGAAGGGGACATCACTACTTTCAGCCATGCTTGGAGAACTTTCACCAATGCCTAGGAATGCAGATGCAAATGCTACTGTTTTTATTCAAGGAGTTGTTACTTATGTTCCACAAGTTTCATGGATTTTTAATGCAACAATGTGTGATAATATTTTATTTGGAGCTACATTTGATTATGCCAAATATGAAAAGATAATCGATATAACTTCATTTTTTCATACCTAGGGCTTGAAGAATCCTCGAGATAGTGGCAGTGCTTGTTGAATTTTTATGAAA ATGCTTGGAGAACTTTCACCAATGCCTAGGAATGCAGATGCAAATGCTACTGTTTTTATTCAAGGAGTTGTTACTTATGTTCCACAAGTTTCATGGATTTTTAATGCAACAATGTGTGATAATATTTTATTTGGAGCTACATTTGATTATGCCAAATATGAAAAGATAATCGATATAACTTCATTTTTTCATACCTAG MLGELSPMPRNADANATVFIQGVVTYVPQVSWIFNATMCDNILFGATFDYAKYEKIIDITSFFHT Homology
BLAST of MELO3C029332.1 vs. NCBI nr
Match: TYK01412.1 (ABC transporter C family member 2-like isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 102.4 bits (254), Expect = 1.5e-18 Identity = 49/61 (80.33%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of MELO3C029332.1 vs. NCBI nr
Match: EOX96954.1 (Multidrug resistance-associated protein 2 isoform 1 [Theobroma cacao]) HSP 1 Score: 83.6 bits (205), Expect = 7.0e-13 Identity = 41/64 (64.06%), Postives = 50/64 (78.12%), Query Frame = 0
BLAST of MELO3C029332.1 vs. NCBI nr
Match: EOX96956.1 (Multidrug resistance-associated protein 2 isoform 3 [Theobroma cacao]) HSP 1 Score: 83.6 bits (205), Expect = 7.0e-13 Identity = 41/64 (64.06%), Postives = 50/64 (78.12%), Query Frame = 0
BLAST of MELO3C029332.1 vs. NCBI nr
Match: EOX96955.1 (Multidrug resistance-associated protein 2 isoform 2, partial [Theobroma cacao]) HSP 1 Score: 83.6 bits (205), Expect = 7.0e-13 Identity = 41/64 (64.06%), Postives = 50/64 (78.12%), Query Frame = 0
BLAST of MELO3C029332.1 vs. NCBI nr
Match: XP_022762661.1 (ABC transporter C family member 2-like [Durio zibethinus]) HSP 1 Score: 83.2 bits (204), Expect = 9.2e-13 Identity = 40/64 (62.50%), Postives = 50/64 (78.12%), Query Frame = 0
BLAST of MELO3C029332.1 vs. ExPASy Swiss-Prot
Match: Q9C8G9 (ABC transporter C family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCC1 PE=1 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 6.6e-14 Identity = 39/64 (60.94%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of MELO3C029332.1 vs. ExPASy Swiss-Prot
Match: Q42093 (ABC transporter C family member 2 OS=Arabidopsis thaliana OX=3702 GN=ABCC2 PE=1 SV=2) HSP 1 Score: 72.0 bits (175), Expect = 2.8e-12 Identity = 37/64 (57.81%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of MELO3C029332.1 vs. ExPASy Swiss-Prot
Match: Q9C8H1 (ABC transporter C family member 11 OS=Arabidopsis thaliana OX=3702 GN=ABCC11 PE=2 SV=2) HSP 1 Score: 63.5 bits (153), Expect = 9.9e-10 Identity = 33/64 (51.56%), Postives = 44/64 (68.75%), Query Frame = 0
BLAST of MELO3C029332.1 vs. ExPASy Swiss-Prot
Match: Q9C8H0 (ABC transporter C family member 12 OS=Arabidopsis thaliana OX=3702 GN=ABCC12 PE=2 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.7e-09 Identity = 34/64 (53.12%), Postives = 45/64 (70.31%), Query Frame = 0
BLAST of MELO3C029332.1 vs. ExPASy Swiss-Prot
Match: Q54JR2 (ABC transporter C family member 3 OS=Dictyostelium discoideum OX=44689 GN=abcC3 PE=3 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 4.1e-08 Identity = 27/59 (45.76%), Postives = 41/59 (69.49%), Query Frame = 0
BLAST of MELO3C029332.1 vs. ExPASy TrEMBL
Match: A0A5D3BRL7 (ABC transporter C family member 2-like isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold29G001130 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 7.1e-19 Identity = 49/61 (80.33%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of MELO3C029332.1 vs. ExPASy TrEMBL
Match: A0A061DXZ5 (Multidrug resistance-associated protein 2 isoform 3 OS=Theobroma cacao OX=3641 GN=TCM_006080 PE=4 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 3.4e-13 Identity = 41/64 (64.06%), Postives = 50/64 (78.12%), Query Frame = 0
BLAST of MELO3C029332.1 vs. ExPASy TrEMBL
Match: A0A061DW72 (Multidrug resistance-associated protein 2 isoform 2 (Fragment) OS=Theobroma cacao OX=3641 GN=TCM_006080 PE=4 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 3.4e-13 Identity = 41/64 (64.06%), Postives = 50/64 (78.12%), Query Frame = 0
BLAST of MELO3C029332.1 vs. ExPASy TrEMBL
Match: A0A061DVW6 (Multidrug resistance-associated protein 2 isoform 1 OS=Theobroma cacao OX=3641 GN=TCM_006080 PE=4 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 3.4e-13 Identity = 41/64 (64.06%), Postives = 50/64 (78.12%), Query Frame = 0
BLAST of MELO3C029332.1 vs. ExPASy TrEMBL
Match: A0A6P6AD05 (ABC transporter C family member 2-like OS=Durio zibethinus OX=66656 GN=LOC111308549 PE=4 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 4.4e-13 Identity = 40/64 (62.50%), Postives = 50/64 (78.12%), Query Frame = 0
BLAST of MELO3C029332.1 vs. TAIR 10
Match: AT1G30400.1 (multidrug resistance-associated protein 1 ) HSP 1 Score: 77.4 bits (189), Expect = 4.7e-15 Identity = 39/64 (60.94%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of MELO3C029332.1 vs. TAIR 10
Match: AT1G30400.2 (multidrug resistance-associated protein 1 ) HSP 1 Score: 77.4 bits (189), Expect = 4.7e-15 Identity = 39/64 (60.94%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of MELO3C029332.1 vs. TAIR 10
Match: AT2G34660.1 (multidrug resistance-associated protein 2 ) HSP 1 Score: 72.0 bits (175), Expect = 2.0e-13 Identity = 37/64 (57.81%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of MELO3C029332.1 vs. TAIR 10
Match: AT2G34660.2 (multidrug resistance-associated protein 2 ) HSP 1 Score: 72.0 bits (175), Expect = 2.0e-13 Identity = 37/64 (57.81%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of MELO3C029332.1 vs. TAIR 10
Match: AT1G30420.1 (multidrug resistance-associated protein 12 ) HSP 1 Score: 63.5 bits (153), Expect = 7.0e-11 Identity = 33/64 (51.56%), Postives = 44/64 (68.75%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|