MELO.jh018456.1.t1 (mRNA) Melon (Harukei-3) v1.41
Overview
Sequences
The following sequences are available for this feature:
Legend: exonstart_codonCDSpolypeptidestop_codon Hold the cursor over a type above to highlight its positions in the sequence below.TACTAGTTATGATAATGTTTGTTGCTCTGCTAATGTTAAGATAATGTTTTCAGAGGGAAGCTGAAATGCAAGGAATGTATGCAAGGCAGTCGCGGACAAGGGAAGAGGTAGAGACATTGTATGAAAAAGATGAAGACGAGCATGGTGACACCTTACGTGGGGCATGCGGTGAACTATACTTCAGATGAATTTTGGATTTGCTGTGATATCTGTGAGAAATGGTTCCATGAGAAATTTGTTGTATGA TACTAGTTATGATAATGTTTGTTGCTCTGCTAATGTTAAGATAATGTTTTCAGAGGGAAGCTGAAATGCAAGGAATGTATGCAAGGCAGTCGCGGACAAGGGAAGAGGTAGAGACATTGTATGAAAAAGATGAAGACGAGCATGGTGACACCTTACGTGGGGCATGCGGTGAACTATACTTCAGATGAATTTTGGATTTGCTGTGATATCTGTGAGAAATGGTTCCATGAGAAATTTGTTGTATGA ATGAAAAAGATGAAGACGAGCATGGTGACACCTTACGTGGGGCATGCGGTGAACTATACTTCAGATGAATTTTGGATTTGCTGTGATATCTGTGAGAAATGGTTCCATGAGAAATTTGTTGTATGA MKKMKTSMVTPYVGHAVNYTSDEFWICCDICEKWFHEKFVV Homology
BLAST of MELO.jh018456.1.t1 vs. NCBI nr
Match: TYK28121.1 (PHD finger protein ALFIN-LIKE 3-like isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 55.8 bits (133), Expect = 2.26e-08 Identity = 21/24 (87.50%), Postives = 22/24 (91.67%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. NCBI nr
Match: KAA0055918.1 (PHD finger protein ALFIN-LIKE 3-like isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 55.8 bits (133), Expect = 2.90e-08 Identity = 21/24 (87.50%), Postives = 22/24 (91.67%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. NCBI nr
Match: KAA0065879.1 (PHD finger protein ALFIN-LIKE 3-like isoform X2 [Cucumis melo var. makuwa] >TYK15138.1 PHD finger protein ALFIN-LIKE 3-like isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 57.0 bits (136), Expect = 4.41e-08 Identity = 22/24 (91.67%), Postives = 22/24 (91.67%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. NCBI nr
Match: KAA0036625.1 (PHD finger protein ALFIN-LIKE 3-like isoform X1 [Cucumis melo var. makuwa] >TYK03364.1 PHD finger protein ALFIN-LIKE 3-like isoform X1 [Cucumis melo var. makuwa]) HSP 1 Score: 54.7 bits (130), Expect = 5.29e-08 Identity = 21/24 (87.50%), Postives = 21/24 (87.50%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. NCBI nr
Match: ABO82473.1 (unknown, partial [Helianthus annuus] >ABO82490.1 unknown, partial [Helianthus petiolaris] >ABO82503.1 unknown, partial [Helianthus anomalus] >ABO82474.1 unknown, partial [Helianthus annuus] >ABO82475.1 unknown, partial [Helianthus annuus]) HSP 1 Score: 52.4 bits (124), Expect = 1.33e-07 Identity = 20/23 (86.96%), Postives = 20/23 (86.96%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. ExPASy Swiss-Prot
Match: Q9FFF5 (PHD finger protein ALFIN-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=AL1 PE=1 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 3.2e-06 Identity = 17/23 (73.91%), Postives = 21/23 (91.30%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. ExPASy Swiss-Prot
Match: Q5XEM9 (PHD finger protein ALFIN-LIKE 5 OS=Arabidopsis thaliana OX=3702 GN=AL5 PE=2 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 5.4e-06 Identity = 18/23 (78.26%), Postives = 20/23 (86.96%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. ExPASy Swiss-Prot
Match: Q40359 (PHD finger protein Alfin1 OS=Medicago sativa OX=3879 GN=ALFIN-1 PE=1 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 7.1e-06 Identity = 18/23 (78.26%), Postives = 20/23 (86.96%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. ExPASy Swiss-Prot
Match: Q8S8M9 (PHD finger protein ALFIN-LIKE 6 OS=Arabidopsis thaliana OX=3702 GN=AL6 PE=1 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 1.2e-05 Identity = 18/23 (78.26%), Postives = 19/23 (82.61%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. ExPASy Swiss-Prot
Match: B8B8C5 (PHD finger protein ALFIN-LIKE 9 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_26819 PE=3 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 1.2e-05 Identity = 18/23 (78.26%), Postives = 20/23 (86.96%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. ExPASy TrEMBL
Match: A0A5D3DWW0 (PHD finger protein ALFIN-LIKE 3-like isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold289G00270 PE=4 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 1.10e-08 Identity = 21/24 (87.50%), Postives = 22/24 (91.67%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. ExPASy TrEMBL
Match: A0A5A7ULG0 (PHD finger protein ALFIN-LIKE 3-like isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold319G00370 PE=4 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 1.40e-08 Identity = 21/24 (87.50%), Postives = 22/24 (91.67%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. ExPASy TrEMBL
Match: A0A5D3CV69 (PHD finger protein ALFIN-LIKE 3-like isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold259G00760 PE=4 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 2.14e-08 Identity = 22/24 (91.67%), Postives = 22/24 (91.67%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. ExPASy TrEMBL
Match: A0A5D3BW61 (PHD finger protein ALFIN-LIKE 3-like isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold2392G00260 PE=4 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 2.56e-08 Identity = 21/24 (87.50%), Postives = 21/24 (87.50%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. ExPASy TrEMBL
Match: A9PZW2 (PHD-type domain-containing protein (Fragment) OS=Helianthus annuus OX=4232 GN=HT953 PE=4 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 6.46e-08 Identity = 20/23 (86.96%), Postives = 20/23 (86.96%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. TAIR 10
Match: AT5G05610.1 (alfin-like 1 ) HSP 1 Score: 51.2 bits (121), Expect = 2.3e-07 Identity = 17/23 (73.91%), Postives = 21/23 (91.30%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. TAIR 10
Match: AT5G05610.2 (alfin-like 1 ) HSP 1 Score: 51.2 bits (121), Expect = 2.3e-07 Identity = 17/23 (73.91%), Postives = 21/23 (91.30%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. TAIR 10
Match: AT5G20510.1 (alfin-like 5 ) HSP 1 Score: 50.4 bits (119), Expect = 3.9e-07 Identity = 18/23 (78.26%), Postives = 20/23 (86.96%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. TAIR 10
Match: AT2G02470.1 (alfin-like 6 ) HSP 1 Score: 49.3 bits (116), Expect = 8.6e-07 Identity = 18/23 (78.26%), Postives = 19/23 (82.61%), Query Frame = 0
BLAST of MELO.jh018456.1.t1 vs. TAIR 10
Match: AT2G02470.2 (alfin-like 6 ) HSP 1 Score: 49.3 bits (116), Expect = 8.6e-07 Identity = 18/23 (78.26%), Postives = 19/23 (82.61%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Harukei-3) v1.41
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following start_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|