
Lsi11G011400.1 (mRNA) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGATGGCGCAGTGGTGCGGCGCAGTAGCTAAGGGAGTGATGGCGGCGGAGCGACGGTCTCCTTCTCTAACGTCGTCCATGGCGGTCGAAGGACTGGTGCCGATCCTCTGTGGACGAGGTGACAAGAAGACGAAGAAAGGGAAAATATTCAAAGGCTCGTACGGAAACGCCAGGCCGAAGAAGGAGAAGAAGATACAGCGAATCAAGGATAAAGTTGAGGTTCCTAGTTCCACTCCTTGGCCTCTTCCTTTCAAGCTCATCTGA ATGGCGATGGCGCAGTGGTGCGGCGCAGTAGCTAAGGGAGTGATGGCGGCGGAGCGACGGTCTCCTTCTCTAACGTCGTCCATGGCGGTCGAAGGACTGGTGCCGATCCTCTGTGGACGAGGTGACAAGAAGACGAAGAAAGGGAAAATATTCAAAGGCTCGTACGGAAACGCCAGGCCGAAGAAGGAGAAGAAGATACAGCGAATCAAGGATAAAGTTGAGGTTCCTAGTTCCACTCCTTGGCCTCTTCCTTTCAAGCTCATCTGA ATGGCGATGGCGCAGTGGTGCGGCGCAGTAGCTAAGGGAGTGATGGCGGCGGAGCGACGGTCTCCTTCTCTAACGTCGTCCATGGCGGTCGAAGGACTGGTGCCGATCCTCTGTGGACGAGGTGACAAGAAGACGAAGAAAGGGAAAATATTCAAAGGCTCGTACGGAAACGCCAGGCCGAAGAAGGAGAAGAAGATACAGCGAATCAAGGATAAAGTTGAGGTTCCTAGTTCCACTCCTTGGCCTCTTCCTTTCAAGCTCATCTGA MAMAQWCGAVAKGVMAAERRSPSLTSSMAVEGLVPILCGRGDKKTKKGKIFKGSYGNARPKKEKKIQRIKDKVEVPSSTPWPLPFKLI Homology
BLAST of Lsi11G011400.1 vs. ExPASy Swiss-Prot
Match: Q9SJU8 (30S ribosomal protein S31, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g21290 PE=1 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 9.5e-24 Identity = 57/98 (58.16%), Postives = 67/98 (68.37%), Query Frame = 0
BLAST of Lsi11G011400.1 vs. ExPASy Swiss-Prot
Match: P47909 (30S ribosomal protein S31, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=Os09g0528100 PE=3 SV=2) HSP 1 Score: 99.0 bits (245), Expect = 2.9e-20 Identity = 45/53 (84.91%), Postives = 50/53 (94.34%), Query Frame = 0
BLAST of Lsi11G011400.1 vs. ExPASy Swiss-Prot
Match: P47910 (30S ribosomal protein S31, chloroplastic OS=Spinacia oleracea OX=3562 GN=RPS31 PE=1 SV=2) HSP 1 Score: 49.3 bits (116), Expect = 2.6e-05 Identity = 26/54 (48.15%), Postives = 37/54 (68.52%), Query Frame = 0
BLAST of Lsi11G011400.1 vs. ExPASy Swiss-Prot
Match: O80439 (30S ribosomal protein S31, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RPS31 PE=1 SV=1) HSP 1 Score: 45.4 bits (106), Expect = 3.8e-04 Identity = 23/45 (51.11%), Postives = 31/45 (68.89%), Query Frame = 0
BLAST of Lsi11G011400.1 vs. ExPASy TrEMBL
Match: A0A6J1F3E9 (30S ribosomal protein S31, mitochondrial OS=Cucurbita moschata OX=3662 GN=LOC111439636 PE=3 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 7.5e-40 Identity = 85/88 (96.59%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Lsi11G011400.1 vs. ExPASy TrEMBL
Match: A0A6J1GKP4 (30S ribosomal protein S31, mitochondrial-like OS=Cucurbita moschata OX=3662 GN=LOC111455241 PE=3 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 1.4e-38 Identity = 83/86 (96.51%), Postives = 85/86 (98.84%), Query Frame = 0
BLAST of Lsi11G011400.1 vs. ExPASy TrEMBL
Match: A0A5A7SX60 (30S ribosomal protein S31 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1428G001030 PE=3 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 7.0e-38 Identity = 81/88 (92.05%), Postives = 86/88 (97.73%), Query Frame = 0
BLAST of Lsi11G011400.1 vs. ExPASy TrEMBL
Match: A0A6J1I644 (30S ribosomal protein S31, mitochondrial OS=Cucurbita maxima OX=3661 GN=LOC111470248 PE=3 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 7.0e-38 Identity = 82/86 (95.35%), Postives = 84/86 (97.67%), Query Frame = 0
BLAST of Lsi11G011400.1 vs. ExPASy TrEMBL
Match: A0A1S3BI88 (30S ribosomal protein S31, mitochondrial OS=Cucumis melo OX=3656 GN=LOC103490344 PE=3 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 7.0e-38 Identity = 81/88 (92.05%), Postives = 86/88 (97.73%), Query Frame = 0
BLAST of Lsi11G011400.1 vs. NCBI nr
Match: XP_022933003.1 (30S ribosomal protein S31, mitochondrial [Cucurbita moschata] >XP_023529502.1 30S ribosomal protein S31, mitochondrial isoform X1 [Cucurbita pepo subsp. pepo] >XP_023529503.1 30S ribosomal protein S31, mitochondrial isoform X2 [Cucurbita pepo subsp. pepo] >KAG6588415.1 30S ribosomal protein S31, mitochondrial, partial [Cucurbita argyrosperma subsp. sororia] >KAG7022258.1 30S ribosomal protein S31, mitochondrial, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 172.6 bits (436), Expect = 1.6e-39 Identity = 85/88 (96.59%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Lsi11G011400.1 vs. NCBI nr
Match: XP_022952601.1 (30S ribosomal protein S31, mitochondrial-like [Cucurbita moschata]) HSP 1 Score: 168.3 bits (425), Expect = 2.9e-38 Identity = 83/86 (96.51%), Postives = 85/86 (98.84%), Query Frame = 0
BLAST of Lsi11G011400.1 vs. NCBI nr
Match: XP_008448047.1 (PREDICTED: 30S ribosomal protein S31, mitochondrial [Cucumis melo] >KAA0033759.1 30S ribosomal protein S31 [Cucumis melo var. makuwa] >TYK22378.1 30S ribosomal protein S31 [Cucumis melo var. makuwa]) HSP 1 Score: 166.0 bits (419), Expect = 1.5e-37 Identity = 81/88 (92.05%), Postives = 86/88 (97.73%), Query Frame = 0
BLAST of Lsi11G011400.1 vs. NCBI nr
Match: XP_022971575.1 (30S ribosomal protein S31, mitochondrial [Cucurbita maxima]) HSP 1 Score: 166.0 bits (419), Expect = 1.5e-37 Identity = 82/86 (95.35%), Postives = 84/86 (97.67%), Query Frame = 0
BLAST of Lsi11G011400.1 vs. NCBI nr
Match: XP_022969451.1 (30S ribosomal protein S31, mitochondrial-like [Cucurbita maxima]) HSP 1 Score: 165.6 bits (418), Expect = 1.9e-37 Identity = 82/86 (95.35%), Postives = 84/86 (97.67%), Query Frame = 0
BLAST of Lsi11G011400.1 vs. TAIR 10
Match: AT2G21290.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: mitochondrion; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; Has 63 Blast hits to 63 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 63; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 110.5 bits (275), Expect = 6.8e-25 Identity = 57/98 (58.16%), Postives = 67/98 (68.37%), Query Frame = 0
BLAST of Lsi11G011400.1 vs. TAIR 10
Match: AT2G38140.1 (plastid-specific ribosomal protein 4 ) HSP 1 Score: 45.4 bits (106), Expect = 2.7e-05 Identity = 23/45 (51.11%), Postives = 31/45 (68.89%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|