
IVF0025706.1 (mRNA) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCATCAAGGTCTCACATATCCTTAACAATATTCAAATCTTGTTTCACAAGCTTCATCTCCAGAGCATCGATGGCTCGTACCAAACAAACAGCCCGTAAATCTACTGGCGGCAAGGCTCCTCGGAAGCAATTGGCTACTAAGGCCGCTCGAAAGTCGGCTCCGGCGACTGGAGGAGTAAAGAAGCCCCACAGATTCAGGCCGGGGACAGTGGCACTAAGAGAGATCCGAAAGTATCAGAAGAGCACGGAACTTCTGATCCGAAAGCTTCCATTCCAAAGGCTAGTTAGAGAAATCGCTCAGGATTTCAAGACTGATCTTCGGTTCCAAAGCAGCGCTGTTTCGGCACTGCAGGAAGCGGCAGAGGCTTATCTTGTGGGATTGTTTGAAGATACTAACCTGTGTGCGATTCATGCTAAGAGAGTAACCATTATGCCTAAAGACATTCAATTAGCCAGACGGATTAGAGGCGAGAGAGCTTAGAGATCTACTGATGAATCATCATTTTGGCGTTTGATATGTAGAATCCTTGCGTAGTTCAATCTTGTCTAGTTCTTACTTACTTTCTGGATCTTTTTGTTTCTTAGAAATGCAATCGCGTTTTATGGCAAGTTTGGTGTATGATTTAAATCTAAT ATGCCATCAAGGTCTCACATATCCTTAACAATATTCAAATCTTGTTTCACAAGCTTCATCTCCAGAGCATCGATGGCTCGTACCAAACAAACAGCCCGTAAATCTACTGGCGGCAAGGCTCCTCGGAAGCAATTGGCTACTAAGGCCGCTCGAAAGTCGGCTCCGGCGACTGGAGGAGTAAAGAAGCCCCACAGATTCAGGCCGGGGACAGTGGCACTAAGAGAGATCCGAAAGTATCAGAAGAGCACGGAACTTCTGATCCGAAAGCTTCCATTCCAAAGGCTAGTTAGAGAAATCGCTCAGGATTTCAAGACTGATCTTCGGTTCCAAAGCAGCGCTGTTTCGGCACTGCAGGAAGCGGCAGAGGCTTATCTTGTGGGATTGTTTGAAGATACTAACCTGTGTGCGATTCATGCTAAGAGAGTAACCATTATGCCTAAAGACATTCAATTAGCCAGACGGATTAGAGGCGAGAGAGCTTAGAGATCTACTGATGAATCATCATTTTGGCGTTTGATATGTAGAATCCTTGCGTAGTTCAATCTTGTCTAGTTCTTACTTACTTTCTGGATCTTTTTGTTTCTTAGAAATGCAATCGCGTTTTATGGCAAGTTTGGTGTATGATTTAAATCTAAT ATGCCATCAAGGTCTCACATATCCTTAACAATATTCAAATCTTGTTTCACAAGCTTCATCTCCAGAGCATCGATGGCTCGTACCAAACAAACAGCCCGTAAATCTACTGGCGGCAAGGCTCCTCGGAAGCAATTGGCTACTAAGGCCGCTCGAAAGTCGGCTCCGGCGACTGGAGGAGTAAAGAAGCCCCACAGATTCAGGCCGGGGACAGTGGCACTAAGAGAGATCCGAAAGTATCAGAAGAGCACGGAACTTCTGATCCGAAAGCTTCCATTCCAAAGGCTAGTTAGAGAAATCGCTCAGGATTTCAAGACTGATCTTCGGTTCCAAAGCAGCGCTGTTTCGGCACTGCAGGAAGCGGCAGAGGCTTATCTTGTGGGATTGTTTGAAGATACTAACCTGTGTGCGATTCATGCTAAGAGAGTAACCATTATGCCTAAAGACATTCAATTAGCCAGACGGATTAGAGGCGAGAGAGCTTAG MPSRSHISLTIFKSCFTSFISRASMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA Homology
BLAST of IVF0025706.1 vs. ExPASy Swiss-Prot
Match: P68429 (Histone H3.2 OS=Medicago sativa OX=3879 GN=H3-1.1 PE=1 SV=2) HSP 1 Score: 254.6 bits (649), Expect = 7.4e-67 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of IVF0025706.1 vs. ExPASy Swiss-Prot
Match: P68430 (Histone H3.2 OS=Onobrychis viciifolia OX=3882 PE=2 SV=2) HSP 1 Score: 254.6 bits (649), Expect = 7.4e-67 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of IVF0025706.1 vs. ExPASy Swiss-Prot
Match: P68427 (Histone H3.2 OS=Pisum sativum OX=3888 PE=1 SV=2) HSP 1 Score: 254.6 bits (649), Expect = 7.4e-67 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of IVF0025706.1 vs. ExPASy Swiss-Prot
Match: P68428 (Histone H3.2 OS=Triticum aestivum OX=4565 PE=1 SV=2) HSP 1 Score: 254.6 bits (649), Expect = 7.4e-67 Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of IVF0025706.1 vs. ExPASy Swiss-Prot
Match: P59226 (Histone H3.2 OS=Arabidopsis thaliana OX=3702 GN=HTR2 PE=1 SV=2) HSP 1 Score: 253.4 bits (646), Expect = 1.7e-66 Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of IVF0025706.1 vs. ExPASy TrEMBL
Match: R0IBZ4 (Histone domain-containing protein (Fragment) OS=Capsella rubella OX=81985 GN=CARUB_v10021660mg PE=3 SV=1) HSP 1 Score: 258.1 bits (658), Expect = 2.5e-65 Identity = 143/162 (88.27%), Postives = 148/162 (91.36%), Query Frame = 0
BLAST of IVF0025706.1 vs. ExPASy TrEMBL
Match: A0A446K952 (Uncharacterized protein OS=Triticum turgidum subsp. durum OX=4567 GN=TRITD_1Bv1G195880 PE=3 SV=1) HSP 1 Score: 256.9 bits (655), Expect = 5.5e-65 Identity = 138/139 (99.28%), Postives = 138/139 (99.28%), Query Frame = 0
BLAST of IVF0025706.1 vs. ExPASy TrEMBL
Match: A0A1S2YZT5 (Histone H3.2 OS=Cicer arietinum OX=3827 GN=LOC101494545 PE=3 SV=1) HSP 1 Score: 256.9 bits (655), Expect = 5.5e-65 Identity = 142/159 (89.31%), Postives = 144/159 (90.57%), Query Frame = 0
BLAST of IVF0025706.1 vs. ExPASy TrEMBL
Match: A0A0D2R575 (Histone domain-containing protein OS=Gossypium raimondii OX=29730 GN=B456_004G277300 PE=3 SV=1) HSP 1 Score: 256.5 bits (654), Expect = 7.2e-65 Identity = 140/158 (88.61%), Postives = 149/158 (94.30%), Query Frame = 0
BLAST of IVF0025706.1 vs. ExPASy TrEMBL
Match: A0A6J0MQA6 (histone H3-like centromeric protein CSE4 OS=Raphanus sativus OX=3726 GN=LOC108845648 PE=3 SV=1) HSP 1 Score: 256.5 bits (654), Expect = 7.2e-65 Identity = 141/158 (89.24%), Postives = 145/158 (91.77%), Query Frame = 0
BLAST of IVF0025706.1 vs. NCBI nr
Match: EOA34158.1 (hypothetical protein CARUB_v10021660mg, partial [Capsella rubella]) HSP 1 Score: 257 bits (656), Expect = 4.40e-85 Identity = 143/162 (88.27%), Postives = 148/162 (91.36%), Query Frame = 0
BLAST of IVF0025706.1 vs. NCBI nr
Match: WP_212576888.1 (histone H3, partial [Vibrio parahaemolyticus]) HSP 1 Score: 256 bits (653), Expect = 8.99e-85 Identity = 138/143 (96.50%), Postives = 140/143 (97.90%), Query Frame = 0
BLAST of IVF0025706.1 vs. NCBI nr
Match: KAG7558967.1 (Histone-fold, partial [Arabidopsis thaliana x Arabidopsis arenosa]) HSP 1 Score: 256 bits (653), Expect = 9.30e-85 Identity = 140/153 (91.50%), Postives = 143/153 (93.46%), Query Frame = 0
BLAST of IVF0025706.1 vs. NCBI nr
Match: KAG7596389.1 (Histone H2A/H2B/H3, partial [Arabidopsis suecica]) HSP 1 Score: 256 bits (653), Expect = 1.06e-84 Identity = 146/159 (91.82%), Postives = 149/159 (93.71%), Query Frame = 0
BLAST of IVF0025706.1 vs. NCBI nr
Match: KAG7645649.1 (histone H3/CENP-A, partial [Arabidopsis thaliana x Arabidopsis arenosa]) HSP 1 Score: 256 bits (653), Expect = 1.22e-84 Identity = 146/159 (91.82%), Postives = 149/159 (93.71%), Query Frame = 0
BLAST of IVF0025706.1 vs. TAIR 10
Match: AT1G09200.1 (Histone superfamily protein ) HSP 1 Score: 253.4 bits (646), Expect = 1.2e-67 Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of IVF0025706.1 vs. TAIR 10
Match: AT3G27360.1 (Histone superfamily protein ) HSP 1 Score: 253.4 bits (646), Expect = 1.2e-67 Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of IVF0025706.1 vs. TAIR 10
Match: AT5G10390.1 (Histone superfamily protein ) HSP 1 Score: 253.4 bits (646), Expect = 1.2e-67 Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of IVF0025706.1 vs. TAIR 10
Match: AT5G10400.1 (Histone superfamily protein ) HSP 1 Score: 253.4 bits (646), Expect = 1.2e-67 Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 0
BLAST of IVF0025706.1 vs. TAIR 10
Match: AT5G65360.1 (Histone superfamily protein ) HSP 1 Score: 253.4 bits (646), Expect = 1.2e-67 Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|