IVF0020978.1 (mRNA) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.CACTTCTCAAAATTTATCATTTTTTTTTTGCTCTTTTAAAGAAAAAGAAAAGTTCTGCATAAAAAAAGTTCCCAATTTCTCAAATGGAAGCAACTCATTCAACTAGGGTTGTGATTATTGACACCAAGTATGTGCAAACGGATGCCAAGAGCTTCAAAACGGTGGTGCAGAAGCTGACGGGCAAAGATTCGGTAGTGGCAGTGGGTGAGGAAATCCGTCGACAAACTGGTAGTGCCCGAAACTCGAGTCTTTTGAGAGATTCTTCGTTCAAAGAGTTCCAAAGAGTGCTGAGAGAGATGCCAAGAATTGATGAGCTTTATTCTGATTGAAATGAATACATACCCA CACTTCTCAAAATTTATCATTTTTTTTTTGCTCTTTTAAAGAAAAAGAAAAGTTCTGCATAAAAAAAGTTCCCAATTTCTCAAATGGAAGCAACTCATTCAACTAGGGTTGTGATTATTGACACCAAGTATGTGCAAACGGATGCCAAGAGCTTCAAAACGGTGGTGCAGAAGCTGACGGGCAAAGATTCGGTAGTGGCAGTGGGTGAGGAAATCCGTCGACAAACTGGTAGTGCCCGAAACTCGAGTCTTTTGAGAGATTCTTCGTTCAAAGAGTTCCAAAGAGTGCTGAGAGAGATGCCAAGAATTGATGAGCTTTATTCTGATTGAAATGAATACATACCCA ATGGAAGCAACTCATTCAACTAGGGTTGTGATTATTGACACCAAGTATGTGCAAACGGATGCCAAGAGCTTCAAAACGGTGGTGCAGAAGCTGACGGGCAAAGATTCGGTAGTGGCAGTGGGTGAGGAAATCCGTCGACAAACTGGTAGTGCCCGAAACTCGAGTCTTTTGAGAGATTCTTCGTTCAAAGAGTTCCAAAGAGTGCTGAGAGAGATGCCAAGAATTGATGAGCTTTATTCTGATTGA MEATHSTRVVIIDTKYVQTDAKSFKTVVQKLTGKDSVVAVGEEIRRQTGSARNSSLLRDSSFKEFQRVLREMPRIDELYSD Homology
BLAST of IVF0020978.1 vs. ExPASy Swiss-Prot
Match: Q8VYI5 (VQ motif-containing protein 10 OS=Arabidopsis thaliana OX=3702 GN=VQ10 PE=1 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 3.0e-08 Identity = 36/92 (39.13%), Postives = 53/92 (57.61%), Query Frame = 0
BLAST of IVF0020978.1 vs. ExPASy Swiss-Prot
Match: Q1G3U8 (VQ motif-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=VQ1 PE=1 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 5.2e-08 Identity = 38/83 (45.78%), Postives = 50/83 (60.24%), Query Frame = 0
BLAST of IVF0020978.1 vs. ExPASy TrEMBL
Match: A0A5A7VBD1 (VQ motif-containing protein 1-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold21G001280 PE=4 SV=1) HSP 1 Score: 153.7 bits (387), Expect = 3.3e-34 Identity = 81/81 (100.00%), Postives = 81/81 (100.00%), Query Frame = 0
BLAST of IVF0020978.1 vs. ExPASy TrEMBL
Match: A0A0A0KXJ0 (VQ domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_4G075740 PE=4 SV=1) HSP 1 Score: 145.6 bits (366), Expect = 9.1e-32 Identity = 77/81 (95.06%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of IVF0020978.1 vs. ExPASy TrEMBL
Match: A0A6J1CNV7 (VQ motif-containing protein 10-like OS=Momordica charantia OX=3673 GN=LOC111012826 PE=4 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 7.0e-16 Identity = 51/69 (73.91%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of IVF0020978.1 vs. ExPASy TrEMBL
Match: A0A6J1FVF7 (VQ motif-containing protein 1 OS=Cucurbita moschata OX=3662 GN=LOC111447218 PE=4 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 1.9e-13 Identity = 48/71 (67.61%), Postives = 54/71 (76.06%), Query Frame = 0
BLAST of IVF0020978.1 vs. ExPASy TrEMBL
Match: A0A4D6M6V8 (VQ domain-containing protein OS=Vigna unguiculata OX=3917 GN=DEO72_LG6g960 PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 2.3e-11 Identity = 43/76 (56.58%), Postives = 56/76 (73.68%), Query Frame = 0
BLAST of IVF0020978.1 vs. NCBI nr
Match: KAA0063001.1 (VQ motif-containing protein 1-like [Cucumis melo var. makuwa] >TYK16346.1 VQ motif-containing protein 1-like [Cucumis melo var. makuwa]) HSP 1 Score: 153 bits (386), Expect = 1.51e-46 Identity = 81/81 (100.00%), Postives = 81/81 (100.00%), Query Frame = 0
BLAST of IVF0020978.1 vs. NCBI nr
Match: KGN53544.1 (hypothetical protein Csa_014778 [Cucumis sativus]) HSP 1 Score: 145 bits (365), Expect = 2.41e-43 Identity = 77/81 (95.06%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of IVF0020978.1 vs. NCBI nr
Match: XP_038889427.1 (VQ motif-containing protein 1-like [Benincasa hispida]) HSP 1 Score: 127 bits (320), Expect = 1.62e-36 Identity = 70/81 (86.42%), Postives = 70/81 (86.42%), Query Frame = 0
BLAST of IVF0020978.1 vs. NCBI nr
Match: KAG6577059.1 (VQ motif-containing protein 1, partial [Cucurbita argyrosperma subsp. sororia] >KAG7015070.1 VQ motif-containing protein 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 105 bits (261), Expect = 1.33e-27 Identity = 62/74 (83.78%), Postives = 63/74 (85.14%), Query Frame = 0
BLAST of IVF0020978.1 vs. NCBI nr
Match: XP_022142787.1 (VQ motif-containing protein 10-like [Momordica charantia]) HSP 1 Score: 92.8 bits (229), Expect = 1.19e-22 Identity = 51/69 (73.91%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of IVF0020978.1 vs. TAIR 10
Match: AT1G78410.1 (VQ motif-containing protein ) HSP 1 Score: 58.9 bits (141), Expect = 2.1e-09 Identity = 36/92 (39.13%), Postives = 53/92 (57.61%), Query Frame = 0
BLAST of IVF0020978.1 vs. TAIR 10
Match: AT1G17147.1 (VQ motif-containing protein ) HSP 1 Score: 58.2 bits (139), Expect = 3.7e-09 Identity = 38/83 (45.78%), Postives = 50/83 (60.24%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following five_prime_UTR feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|