IVF0000987.1 (mRNA) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTGAGAGGAAGGTGCTTAACAAATACTACCCACCGGATTTTGATCCGTCAAAGCTACCAAGGGTTCGTAGACCCAAAAACCAGCAAATGAAGGTTCGTATGATGCTTCCTATGAGCATCCGGTGCAATACTTGTGGTAATTACATATACAAGGGCACAAAGTTCAATTCTCGCAAGGAGGACGTCATTGGTGAGGCAAGGGAATCCCTTTTATATATTTTTTATATTTTTAACCTAAAAGATGTTTATTCCTTTTGTAATTGATTTTCTGATTTCTCATGTATTTTTTTCCTTTTATTTCAGACATATTTGGGAATTCAAATTTTTAGGTTCTACTTCAAGTGTACCAGATGTTCTGCTGAGCTTACCATTAAAACAGACCCCCAAAACTCAGACTACGTTGTAG ATGGGTGAGAGGAAGGTGCTTAACAAATACTACCCACCGGATTTTGATCCGTCAAAGCTACCAAGGGTTCGTAGACCCAAAAACCAGCAAATGAAGGTTCGTATGATGCTTCCTATGAGCATCCGGTGCAATACTTGTGGTAATTACATATACAAGGGCACAAAGTTCAATTCTCGCAAGGAGGACGTCATTGGTTCTACTTCAAGTGTACCAGATGTTCTGCTGAGCTTACCATTAAAACAGACCCCCAAAACTCAGACTACGTTGTAG ATGGGTGAGAGGAAGGTGCTTAACAAATACTACCCACCGGATTTTGATCCGTCAAAGCTACCAAGGGTTCGTAGACCCAAAAACCAGCAAATGAAGGTTCGTATGATGCTTCCTATGAGCATCCGGTGCAATACTTGTGGTAATTACATATACAAGGGCACAAAGTTCAATTCTCGCAAGGAGGACGTCATTGGTTCTACTTCAAGTGTACCAGATGTTCTGCTGAGCTTACCATTAAAACAGACCCCCAAAACTCAGACTACGTTGTAG MGERKVLNKYYPPDFDPSKLPRVRRPKNQQMKVRMMLPMSIRCNTCGNYIYKGTKFNSRKEDVIGSTSSVPDVLLSLPLKQTPKTQTTL Homology
BLAST of IVF0000987.1 vs. ExPASy Swiss-Prot
Match: Q9BW85 (Splicing factor YJU2 OS=Homo sapiens OX=9606 GN=YJU2 PE=1 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 5.8e-21 Identity = 47/79 (59.49%), Postives = 59/79 (74.68%), Query Frame = 0
BLAST of IVF0000987.1 vs. ExPASy Swiss-Prot
Match: A8WHR3 (Splicing factor YJU2 OS=Danio rerio OX=7955 GN=yju2 PE=1 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 7.6e-21 Identity = 43/63 (68.25%), Postives = 53/63 (84.13%), Query Frame = 0
BLAST of IVF0000987.1 vs. ExPASy Swiss-Prot
Match: Q9D6J3 (Splicing factor YJU2 OS=Mus musculus OX=10090 GN=Yju2 PE=1 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 7.6e-21 Identity = 43/63 (68.25%), Postives = 53/63 (84.13%), Query Frame = 0
BLAST of IVF0000987.1 vs. ExPASy Swiss-Prot
Match: Q54WR5 (Splicing factor YJU2 OS=Dictyostelium discoideum OX=44689 GN=yju2 PE=3 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 3.5e-18 Identity = 41/63 (65.08%), Postives = 51/63 (80.95%), Query Frame = 0
BLAST of IVF0000987.1 vs. ExPASy Swiss-Prot
Match: Q9P7C5 (Splicing factor YJU2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf16 PE=1 SV=2) HSP 1 Score: 81.6 bits (200), Expect = 4.8e-15 Identity = 39/66 (59.09%), Postives = 48/66 (72.73%), Query Frame = 0
BLAST of IVF0000987.1 vs. ExPASy TrEMBL
Match: A0A0B0MV50 (Splicing factor YJU2 OS=Gossypium arboreum OX=29729 GN=LOC108474488 PE=3 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 8.4e-31 Identity = 66/67 (98.51%), Postives = 66/67 (98.51%), Query Frame = 0
BLAST of IVF0000987.1 vs. ExPASy TrEMBL
Match: A0A6P9EB24 (Splicing factor YJU2 OS=Juglans regia OX=51240 GN=LOC109011793 PE=3 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 8.4e-31 Identity = 66/67 (98.51%), Postives = 66/67 (98.51%), Query Frame = 0
BLAST of IVF0000987.1 vs. ExPASy TrEMBL
Match: A0A6P9ED46 (Splicing factor YJU2 OS=Juglans regia OX=51240 GN=LOC118348244 PE=3 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 8.4e-31 Identity = 66/67 (98.51%), Postives = 66/67 (98.51%), Query Frame = 0
BLAST of IVF0000987.1 vs. ExPASy TrEMBL
Match: A0A6J1AVA5 (Splicing factor YJU2 OS=Herrania umbratica OX=108875 GN=LOC110421628 PE=3 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 8.4e-31 Identity = 66/67 (98.51%), Postives = 66/67 (98.51%), Query Frame = 0
BLAST of IVF0000987.1 vs. ExPASy TrEMBL
Match: A0A5D2RD26 (Splicing factor YJU2 OS=Gossypium tomentosum OX=34277 GN=ES332_A02G008700v1 PE=3 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 8.4e-31 Identity = 66/67 (98.51%), Postives = 66/67 (98.51%), Query Frame = 0
BLAST of IVF0000987.1 vs. NCBI nr
Match: XP_008466970.1 (PREDICTED: coiled-coil domain-containing protein 94 homolog, partial [Cucumis melo]) HSP 1 Score: 140 bits (354), Expect = 4.59e-41 Identity = 66/67 (98.51%), Postives = 66/67 (98.51%), Query Frame = 0
BLAST of IVF0000987.1 vs. NCBI nr
Match: KAF9840338.1 (hypothetical protein H0E87_008065 [Populus deltoides]) HSP 1 Score: 139 bits (349), Expect = 7.02e-40 Identity = 64/67 (95.52%), Postives = 66/67 (98.51%), Query Frame = 0
BLAST of IVF0000987.1 vs. NCBI nr
Match: XP_016903347.1 (PREDICTED: coiled-coil domain-containing protein 94 homolog, partial [Cucumis melo]) HSP 1 Score: 137 bits (345), Expect = 9.27e-40 Identity = 65/67 (97.01%), Postives = 65/67 (97.01%), Query Frame = 0
BLAST of IVF0000987.1 vs. NCBI nr
Match: KAF9839281.1 (hypothetical protein H0E87_007259 [Populus deltoides]) HSP 1 Score: 143 bits (360), Expect = 1.13e-39 Identity = 67/77 (87.01%), Postives = 72/77 (93.51%), Query Frame = 0
BLAST of IVF0000987.1 vs. NCBI nr
Match: CBI14833.3 (unnamed protein product, partial [Vitis vinifera]) HSP 1 Score: 139 bits (349), Expect = 1.98e-39 Identity = 64/67 (95.52%), Postives = 66/67 (98.51%), Query Frame = 0
BLAST of IVF0000987.1 vs. TAIR 10
Match: AT1G17130.1 (Family of unknown function (DUF572) ) HSP 1 Score: 132.9 bits (333), Expect = 1.3e-31 Identity = 60/67 (89.55%), Postives = 64/67 (95.52%), Query Frame = 0
BLAST of IVF0000987.1 vs. TAIR 10
Match: AT1G17130.2 (Family of unknown function (DUF572) ) HSP 1 Score: 131.7 bits (330), Expect = 2.9e-31 Identity = 60/69 (86.96%), Postives = 64/69 (92.75%), Query Frame = 0
BLAST of IVF0000987.1 vs. TAIR 10
Match: AT3G43250.1 (Family of unknown function (DUF572) ) HSP 1 Score: 110.2 bits (274), Expect = 8.9e-25 Identity = 47/67 (70.15%), Postives = 57/67 (85.07%), Query Frame = 0
BLAST of IVF0000987.1 vs. TAIR 10
Match: AT2G32050.1 (Family of unknown function (DUF572) ) HSP 1 Score: 109.4 bits (272), Expect = 1.5e-24 Identity = 46/67 (68.66%), Postives = 58/67 (86.57%), Query Frame = 0
BLAST of IVF0000987.1 vs. TAIR 10
Match: AT2G29430.1 (Family of unknown function (DUF572) ) HSP 1 Score: 47.4 bits (111), Expect = 7.1e-06 Identity = 20/33 (60.61%), Postives = 24/33 (72.73%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|