HG10013626.1 (mRNA) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGGCAGAATAGGCCAATCCCGCACTGGATCCGCCTGAGAACAGACAACACGATCAGGTATTAAGCCTACGCTATTTGAATCTACATATTTCCCTTTGAATATCTCTATCTCTCTCGGATCGATTTTGAATATTAGTTTCTGACGTTTTAATTTGGATCGTATTACAGATACAACGCAAAGCGCAGGCACTGGCGTCGTACCAAGCTAGGGTTTTGA ATGAGGCAGAATAGGCCAATCCCGCACTGGATCCGCCTGAGAACAGACAACACGATCAGATACAACGCAAAGCGCAGGCACTGGCGTCGTACCAAGCTAGGGTTTTGA ATGAGGCAGAATAGGCCAATCCCGCACTGGATCCGCCTGAGAACAGACAACACGATCAGATACAACGCAAAGCGCAGGCACTGGCGTCGTACCAAGCTAGGGTTTTGA MRQNRPIPHWIRLRTDNTIRYNAKRRHWRRTKLGF Homology
BLAST of HG10013626.1 vs. NCBI nr
Match: NP_180093.1 (Ribosomal protein L39 family protein [Arabidopsis thaliana] >AAD23670.1 60S ribosomal protein L39 [Arabidopsis thaliana] >AEC07671.1 Ribosomal protein L39 family protein [Arabidopsis thaliana]) HSP 1 Score: 79.3 bits (194), Expect = 7.1e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of HG10013626.1 vs. NCBI nr
Match: KAG6481052.1 (hypothetical protein ZIOFF_057644 [Zingiber officinale] >KAG6481057.1 hypothetical protein ZIOFF_057649 [Zingiber officinale]) HSP 1 Score: 79.3 bits (194), Expect = 7.1e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of HG10013626.1 vs. NCBI nr
Match: CAF2068461.1 (unnamed protein product [Brassica napus] >CAG7898384.1 unnamed protein product [Brassica rapa]) HSP 1 Score: 79.3 bits (194), Expect = 7.1e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of HG10013626.1 vs. NCBI nr
Match: KAA0064900.1 (hypothetical protein E6C27_scaffold82G002160 [Cucumis melo var. makuwa]) HSP 1 Score: 79.3 bits (194), Expect = 7.1e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of HG10013626.1 vs. NCBI nr
Match: XP_031480823.1 (60S ribosomal protein L39-like [Nymphaea colorata]) HSP 1 Score: 79.3 bits (194), Expect = 7.1e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of HG10013626.1 vs. ExPASy Swiss-Prot
Match: P51424 (60S ribosomal protein L39-1 OS=Arabidopsis thaliana OX=3702 GN=RPL39A PE=3 SV=2) HSP 1 Score: 79.3 bits (194), Expect = 9.3e-15 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of HG10013626.1 vs. ExPASy Swiss-Prot
Match: Q6KAJ8 (60S ribosomal protein L39-1 OS=Oryza sativa subsp. japonica OX=39947 GN=RPL39A PE=3 SV=2) HSP 1 Score: 76.3 bits (186), Expect = 7.9e-14 Identity = 33/35 (94.29%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of HG10013626.1 vs. ExPASy Swiss-Prot
Match: P51426 (60S ribosomal protein L39-2 OS=Oryza sativa subsp. japonica OX=39947 GN=RPL39B PE=3 SV=2) HSP 1 Score: 76.3 bits (186), Expect = 7.9e-14 Identity = 33/35 (94.29%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of HG10013626.1 vs. ExPASy Swiss-Prot
Match: Q5SMI4 (60S ribosomal protein L39-3 OS=Oryza sativa subsp. japonica OX=39947 GN=RPL39C PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 7.9e-14 Identity = 33/35 (94.29%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of HG10013626.1 vs. ExPASy Swiss-Prot
Match: P51425 (60S ribosomal protein L39 OS=Zea mays OX=4577 GN=RPL39 PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 7.9e-14 Identity = 33/35 (94.29%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of HG10013626.1 vs. ExPASy TrEMBL
Match: A0A6J1HZ80 (60S ribosomal protein L39 OS=Cucurbita maxima OX=3661 GN=LOC111467947 PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 3.5e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of HG10013626.1 vs. ExPASy TrEMBL
Match: A0A0D3BLW0 (Uncharacterized protein OS=Brassica oleracea var. oleracea OX=109376 GN=106332948 PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 3.5e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of HG10013626.1 vs. ExPASy TrEMBL
Match: A0A397Y3W1 (Uncharacterized protein OS=Brassica campestris OX=3711 GN=BRARA_H01324 PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 3.5e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of HG10013626.1 vs. ExPASy TrEMBL
Match: A0A0A0LYE1 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G568530 PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 3.5e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of HG10013626.1 vs. ExPASy TrEMBL
Match: A0A1S3BCZ7 (60S ribosomal protein L39 OS=Cucumis melo OX=3656 GN=LOC103488337 PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 3.5e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of HG10013626.1 vs. TAIR 10
Match: AT2G25210.1 (Ribosomal protein L39 family protein ) HSP 1 Score: 79.3 bits (194), Expect = 6.6e-16 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of HG10013626.1 vs. TAIR 10
Match: AT4G31985.1 (Ribosomal protein L39 family protein ) HSP 1 Score: 79.3 bits (194), Expect = 6.6e-16 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0
BLAST of HG10013626.1 vs. TAIR 10
Match: AT3G02190.1 (Ribosomal protein L39 family protein ) HSP 1 Score: 74.3 bits (181), Expect = 2.1e-14 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|