Cp4.1LG11g05220.1 (mRNA) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCATCATTTCTCCTCTACTCATACTAATAACAACAATTCCTCCTCCTCCTCCTCCTCCTCCGATGCCACCGATGAGCTCACGGAAATCGTCCAGCTACCGACTCTCGGAACGAGTTACGACGGCGGATTCGGTGGTGAGTTTGTGTTTTTTGACTCGGGGCAGGAATTGGAATCTGGGTGTTGGATGTACGCGCCGCCATGGGTGCAGAGCTTGGGGGATTGTGATAATGATGATTATGGTAAGTTCGAAGGATTGCTGTGGGATTATTGA ATGCATCATTTCTCCTCTACTCATACTAATAACAACAATTCCTCCTCCTCCTCCTCCTCCTCCGATGCCACCGATGAGCTCACGGAAATCGTCCAGCTACCGACTCTCGGAACGAGTTACGACGGCGGATTCGGTGGTGAGTTTGTGTTTTTTGACTCGGGGCAGGAATTGGAATCTGGGTGTTGGATGTACGCGCCGCCATGGGTGCAGAGCTTGGGGGATTGTGATAATGATGATTATGGTAAGTTCGAAGGATTGCTGTGGGATTATTGA ATGCATCATTTCTCCTCTACTCATACTAATAACAACAATTCCTCCTCCTCCTCCTCCTCCTCCGATGCCACCGATGAGCTCACGGAAATCGTCCAGCTACCGACTCTCGGAACGAGTTACGACGGCGGATTCGGTGGTGAGTTTGTGTTTTTTGACTCGGGGCAGGAATTGGAATCTGGGTGTTGGATGTACGCGCCGCCATGGGTGCAGAGCTTGGGGGATTGTGATAATGATGATTATGGTAAGTTCGAAGGATTGCTGTGGGATTATTGA MHHFSSTHTNNNNSSSSSSSSDATDELTEIVQLPTLGTSYDGGFGGEFVFFDSGQELESGCWMYAPPWVQSLGDCDNDDYGKFEGLLWDY Homology
BLAST of Cp4.1LG11g05220.1 vs. ExPASy Swiss-Prot
Match: Q9LYD3 (Dehydration-responsive element-binding protein 3 OS=Arabidopsis thaliana OX=3702 GN=DREB3 PE=2 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 1.0e-04 Identity = 40/105 (38.10%), Postives = 54/105 (51.43%), Query Frame = 0
BLAST of Cp4.1LG11g05220.1 vs. ExPASy Swiss-Prot
Match: Q39127 (Ethylene-responsive transcription factor TINY OS=Arabidopsis thaliana OX=3702 GN=TINY PE=2 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 1.0e-04 Identity = 30/67 (44.78%), Postives = 43/67 (64.18%), Query Frame = 0
BLAST of Cp4.1LG11g05220.1 vs. NCBI nr
Match: XP_023546365.1 (ethylene-responsive transcription factor TINY-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 191 bits (484), Expect = 1.25e-58 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 0
BLAST of Cp4.1LG11g05220.1 vs. NCBI nr
Match: XP_022962316.1 (dehydration-responsive element-binding protein 3-like [Cucurbita moschata]) HSP 1 Score: 173 bits (439), Expect = 9.49e-53 Identity = 86/93 (92.47%), Postives = 87/93 (93.55%), Query Frame = 0
BLAST of Cp4.1LG11g05220.1 vs. NCBI nr
Match: KAG7029718.1 (Dehydration-responsive element-binding protein 3, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 170 bits (431), Expect = 1.81e-51 Identity = 86/97 (88.66%), Postives = 87/97 (89.69%), Query Frame = 0
BLAST of Cp4.1LG11g05220.1 vs. NCBI nr
Match: XP_022996591.1 (dehydration-responsive element-binding protein 3-like isoform X3 [Cucurbita maxima]) HSP 1 Score: 169 bits (429), Expect = 2.86e-51 Identity = 81/90 (90.00%), Postives = 85/90 (94.44%), Query Frame = 0
BLAST of Cp4.1LG11g05220.1 vs. NCBI nr
Match: KAG6598779.1 (Dehydration-responsive element-binding protein 3, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 169 bits (427), Expect = 8.26e-51 Identity = 86/101 (85.15%), Postives = 87/101 (86.14%), Query Frame = 0
BLAST of Cp4.1LG11g05220.1 vs. ExPASy TrEMBL
Match: A0A6J1HCS5 (dehydration-responsive element-binding protein 3-like OS=Cucurbita moschata OX=3662 GN=LOC111462803 PE=4 SV=1) HSP 1 Score: 173 bits (439), Expect = 4.60e-53 Identity = 86/93 (92.47%), Postives = 87/93 (93.55%), Query Frame = 0
BLAST of Cp4.1LG11g05220.1 vs. ExPASy TrEMBL
Match: A0A6J1K578 (dehydration-responsive element-binding protein 3-like isoform X3 OS=Cucurbita maxima OX=3661 GN=LOC111491786 PE=4 SV=1) HSP 1 Score: 169 bits (429), Expect = 1.38e-51 Identity = 81/90 (90.00%), Postives = 85/90 (94.44%), Query Frame = 0
BLAST of Cp4.1LG11g05220.1 vs. ExPASy TrEMBL
Match: A0A6J1K2D0 (dehydration-responsive element-binding protein 3-like isoform X4 OS=Cucurbita maxima OX=3661 GN=LOC111491786 PE=4 SV=1) HSP 1 Score: 164 bits (414), Expect = 2.55e-49 Identity = 80/90 (88.89%), Postives = 84/90 (93.33%), Query Frame = 0
BLAST of Cp4.1LG11g05220.1 vs. ExPASy TrEMBL
Match: A0A6J1K785 (dehydration-responsive element-binding protein 3-like isoform X2 OS=Cucurbita maxima OX=3661 GN=LOC111491786 PE=4 SV=1) HSP 1 Score: 163 bits (413), Expect = 4.32e-49 Identity = 81/95 (85.26%), Postives = 85/95 (89.47%), Query Frame = 0
BLAST of Cp4.1LG11g05220.1 vs. ExPASy TrEMBL
Match: A0A6J1K958 (dehydration-responsive element-binding protein 3-like isoform X6 OS=Cucurbita maxima OX=3661 GN=LOC111491786 PE=4 SV=1) HSP 1 Score: 162 bits (410), Expect = 1.00e-48 Identity = 79/90 (87.78%), Postives = 83/90 (92.22%), Query Frame = 0
BLAST of Cp4.1LG11g05220.1 vs. TAIR 10
Match: AT5G11590.1 (Integrase-type DNA-binding superfamily protein ) HSP 1 Score: 47.4 bits (111), Expect = 7.2e-06 Identity = 40/105 (38.10%), Postives = 54/105 (51.43%), Query Frame = 0
BLAST of Cp4.1LG11g05220.1 vs. TAIR 10
Match: AT5G25810.1 (Integrase-type DNA-binding superfamily protein ) HSP 1 Score: 47.4 bits (111), Expect = 7.2e-06 Identity = 30/67 (44.78%), Postives = 43/67 (64.18%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|