
CcUC10G202220.1 (mRNA) Watermelon (PI 537277) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCCCAACAATAGGGGAGAGTGAGCCAGTAAGAATGATTGAGGTGGGAGAGATAGGAAGAAGAAGCTTTAGTTCATCATTATGCCAACAAACTTCAAGTTTCAAAAATGGCTCGACTGCGGCAGTGGCAAAAGATGACAATGTTGAAGATATTACTTCACTTTGGGAGTTAGTTGAGCGACTGCCGATGTTTGAACGATTGAGATCGTCATTGTTTGACGACAGTCTCAATGGAAAAGTTGAGAAAAGAGTTGTTGATGTCACTAAGCTTGGAGATTTGGAGCGCCATCTCTTTATTAAAAAACTCATCAACAACATTGAAAATGATAATCTAAAGCTTTTGAAAAAAATCAAGGAGAGAATCCACAAGTAA ATGGCCCCAACAATAGGGGAGAGTGAGCCAGTAAGAATGATTGAGGTGGGAGAGATAGGAAGAAGAAGCTTTAGTTCATCATTATGCCAACAAACTTCAAGTTTCAAAAATGGCTCGACTGCGGCAGTGGCAAAAGATGACAATGTTGAAGATATTACTTCACTTTGGGAGTTAGTTGAGCGACTGCCGATGTTTGAACGATTGAGATCGTCATTGTTTGACGACAGTCTCAATGGAAAAGTTGAGAAAAGAGTTGTTGATGTCACTAAGCTTGGAGATTTGGAGCGCCATCTCTTTATTAAAAAACTCATCAACAACATTGAAAATGATAATCTAAAGCTTTTGAAAAAAATCAAGGAGAGAATCCACAAGTAA ATGGCCCCAACAATAGGGGAGAGTGAGCCAGTAAGAATGATTGAGGTGGGAGAGATAGGAAGAAGAAGCTTTAGTTCATCATTATGCCAACAAACTTCAAGTTTCAAAAATGGCTCGACTGCGGCAGTGGCAAAAGATGACAATGTTGAAGATATTACTTCACTTTGGGAGTTAGTTGAGCGACTGCCGATGTTTGAACGATTGAGATCGTCATTGTTTGACGACAGTCTCAATGGAAAAGTTGAGAAAAGAGTTGTTGATGTCACTAAGCTTGGAGATTTGGAGCGCCATCTCTTTATTAAAAAACTCATCAACAACATTGAAAATGATAATCTAAAGCTTTTGAAAAAAATCAAGGAGAGAATCCACAAGTAA MAPTIGESEPVRMIEVGEIGRRSFSSSLCQQTSSFKNGSTAAVAKDDNVEDITSLWELVERLPMFERLRSSLFDDSLNGKVEKRVVDVTKLGDLERHLFIKKLINNIENDNLKLLKKIKERIHK Homology
BLAST of CcUC10G202220.1 vs. NCBI nr
Match: XP_038903615.1 (pleiotropic drug resistance protein 3-like isoform X1 [Benincasa hispida]) HSP 1 Score: 153.3 bits (386), Expect = 1.4e-33 Identity = 86/118 (72.88%), Postives = 96/118 (81.36%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. NCBI nr
Match: XP_038903616.1 (pleiotropic drug resistance protein 3-like isoform X2 [Benincasa hispida]) HSP 1 Score: 153.3 bits (386), Expect = 1.4e-33 Identity = 86/118 (72.88%), Postives = 96/118 (81.36%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. NCBI nr
Match: XP_011652141.2 (pleiotropic drug resistance protein 3 [Cucumis sativus] >KGN59512.2 hypothetical protein Csa_002232 [Cucumis sativus]) HSP 1 Score: 141.4 bits (355), Expect = 5.4e-30 Identity = 79/126 (62.70%), Postives = 93/126 (73.81%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. NCBI nr
Match: XP_008443150.1 (PREDICTED: pleiotropic drug resistance protein 3-like isoform X1 [Cucumis melo]) HSP 1 Score: 141.4 bits (355), Expect = 5.4e-30 Identity = 80/126 (63.49%), Postives = 97/126 (76.98%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. NCBI nr
Match: XP_038892176.1 (pleiotropic drug resistance protein 3-like [Benincasa hispida]) HSP 1 Score: 141.4 bits (355), Expect = 5.4e-30 Identity = 86/131 (65.65%), Postives = 99/131 (75.57%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. ExPASy Swiss-Prot
Match: Q5W274 (Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum OX=4097 GN=PDR3 PE=2 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 8.1e-21 Identity = 69/132 (52.27%), Postives = 91/132 (68.94%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. ExPASy Swiss-Prot
Match: Q9LFH0 (ABC transporter G family member 37 OS=Arabidopsis thaliana OX=3702 GN=ABCG37 PE=1 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 4.5e-19 Identity = 61/118 (51.69%), Postives = 77/118 (65.25%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. ExPASy Swiss-Prot
Match: Q9ZUT8 (ABC transporter G family member 33 OS=Arabidopsis thaliana OX=3702 GN=ABCG33 PE=2 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 2.3e-15 Identity = 50/94 (53.19%), Postives = 66/94 (70.21%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. ExPASy Swiss-Prot
Match: Q7PC82 (ABC transporter G family member 42 OS=Arabidopsis thaliana OX=3702 GN=ABCG42 PE=2 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.6e-11 Identity = 37/78 (47.44%), Postives = 54/78 (69.23%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. ExPASy Swiss-Prot
Match: Q7PC83 (ABC transporter G family member 41 OS=Arabidopsis thaliana OX=3702 GN=ABCG41 PE=2 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.7e-10 Identity = 36/76 (47.37%), Postives = 50/76 (65.79%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. ExPASy TrEMBL
Match: A0A0A0LBH1 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G814320 PE=3 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 2.6e-30 Identity = 79/126 (62.70%), Postives = 93/126 (73.81%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. ExPASy TrEMBL
Match: A0A1S3B6X0 (pleiotropic drug resistance protein 3-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103486825 PE=3 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 2.6e-30 Identity = 80/126 (63.49%), Postives = 97/126 (76.98%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. ExPASy TrEMBL
Match: A0A6J1DJT5 (pleiotropic drug resistance protein 3-like OS=Momordica charantia OX=3673 GN=LOC111021552 PE=3 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 2.1e-27 Identity = 77/127 (60.63%), Postives = 95/127 (74.80%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. ExPASy TrEMBL
Match: A0A0A0KMI3 (ABC transporter domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_5G292220 PE=4 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 3.0e-26 Identity = 78/124 (62.90%), Postives = 94/124 (75.81%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. ExPASy TrEMBL
Match: A0A5D3CR38 (Pleiotropic drug resistance protein 3-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold186G00570 PE=4 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 2.5e-25 Identity = 77/125 (61.60%), Postives = 93/125 (74.40%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. TAIR 10
Match: AT3G53480.1 (pleiotropic drug resistance 9 ) HSP 1 Score: 95.5 bits (236), Expect = 3.2e-20 Identity = 61/118 (51.69%), Postives = 77/118 (65.25%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. TAIR 10
Match: AT2G37280.1 (pleiotropic drug resistance 5 ) HSP 1 Score: 83.2 bits (204), Expect = 1.6e-16 Identity = 50/94 (53.19%), Postives = 66/94 (70.21%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. TAIR 10
Match: AT4G15233.1 (ABC-2 and Plant PDR ABC-type transporter family protein ) HSP 1 Score: 69.7 bits (169), Expect = 1.9e-12 Identity = 37/78 (47.44%), Postives = 54/78 (69.23%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. TAIR 10
Match: AT4G15233.2 (ABC-2 and Plant PDR ABC-type transporter family protein ) HSP 1 Score: 69.7 bits (169), Expect = 1.9e-12 Identity = 37/78 (47.44%), Postives = 54/78 (69.23%), Query Frame = 0
BLAST of CcUC10G202220.1 vs. TAIR 10
Match: AT4G15215.1 (pleiotropic drug resistance 13 ) HSP 1 Score: 67.0 bits (162), Expect = 1.2e-11 Identity = 36/76 (47.37%), Postives = 50/76 (65.79%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (PI 537277) v1
Date Performed: 2022-01-31 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|