Spg017745 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTCCTATGTGGAGGCTGCCCCTGGCCAAAATGAGGCTGTATTCCGATGTCCTAATGATATCGAAGTTGGTCAATGGGTACCGATTGAGAATATCAAAGATGACAAATATGTGCAAGAGATCGGAAGGTTTGCAGTGATGGAGCATAACAAGCAAATCGGAGCACACCTTAAGTTCATGTGTGTTGAAAGTGGTGAGAGACAAGTGGTGAATGGAATGAATTACCGTCTTAGGTTGACAGCAGCAGATGGTGGACTGATTTGGCCTTATGAGACTATGGTGTACGATAATGCATCGGAGCACTCATGGAAGCTCATATATTTTGTACCTCTCCTCAAAAACTAATCTACTAATTGTTTTCTCTACTTTACATGATATGCAGTGTTGCATTATCTCTGAATAATAATGGGAGAATAAAATAAAAGCTACCTATGTATAATGGCTTGATTTATGAATAATGTGAGAATAAAATAAAAGTAATCTCGTCTATATCTAATATACCTCTAGTTGGGTGTGCTTTTCTCTTCGTATTCTTTTTCTTCTTTTTTTTCTTTTCTTGATCTCAATTGAAGGCTCAACTAATTCACCCAAGTTTGATCGAGATTCAACATACTTAAAGAGTTTAATGAAAATTAAATACCAAGGATTGACAATAATATTATTTTATTACTTGATAGTGTATACTTGCACTCGAGCAGGTGTTGCATGCGCTAGCAGCACTGCACCGTCAACAATTCTTCGTGAACAGGAGCCCATAA ATGAGTTCCTATGTGGAGGCTGCCCCTGGCCAAAATGAGGCTGTATTCCGATGTCCTAATGATATCGAAGTTGGTCAATGGGTACCGATTGAGAATATCAAAGATGACAAATATGTGCAAGAGATCGGAAGGTTTGCAGTGATGGAGCATAACAAGCAAATCGGAGCACACCTTAAGTTCATGTGTGTTGAAAGTGGTGAGAGACAAGTGGTGAATGGAATGAATTACCGTCTTAGGTTGACAGCAGCAGATGGTGGACTGATTTGGCCTTATGAGACTATGGTGTACGATAATGCATCGGAGCACTCATGGAAGCTCATATATTTTTGTATACTTGCACTCGAGCAGGTGTTGCATGCGCTAGCAGCACTGCACCGTCAACAATTCTTCGTGAACAGGAGCCCATAA ATGAGTTCCTATGTGGAGGCTGCCCCTGGCCAAAATGAGGCTGTATTCCGATGTCCTAATGATATCGAAGTTGGTCAATGGGTACCGATTGAGAATATCAAAGATGACAAATATGTGCAAGAGATCGGAAGGTTTGCAGTGATGGAGCATAACAAGCAAATCGGAGCACACCTTAAGTTCATGTGTGTTGAAAGTGGTGAGAGACAAGTGGTGAATGGAATGAATTACCGTCTTAGGTTGACAGCAGCAGATGGTGGACTGATTTGGCCTTATGAGACTATGGTGTACGATAATGCATCGGAGCACTCATGGAAGCTCATATATTTTTGTATACTTGCACTCGAGCAGGTGTTGCATGCGCTAGCAGCACTGCACCGTCAACAATTCTTCGTGAACAGGAGCCCATAA MSSYVEAAPGQNEAVFRCPNDIEVGQWVPIENIKDDKYVQEIGRFAVMEHNKQIGAHLKFMCVESGERQVVNGMNYRLRLTAADGGLIWPYETMVYDNASEHSWKLIYFCILALEQVLHALAALHRQQFFVNRSP Homology
BLAST of Spg017745 vs. NCBI nr
Match: XP_038897049.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 144.1 bits (362), Expect = 9.1e-31 Identity = 70/110 (63.64%), Postives = 86/110 (78.18%), Query Frame = 0
BLAST of Spg017745 vs. NCBI nr
Match: KAG6592148.1 (Cysteine proteinase inhibitor 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 134.4 bits (337), Expect = 7.2e-28 Identity = 68/110 (61.82%), Postives = 80/110 (72.73%), Query Frame = 0
BLAST of Spg017745 vs. NCBI nr
Match: KAG6592144.1 (Cysteine proteinase inhibitor 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 134.0 bits (336), Expect = 9.4e-28 Identity = 68/110 (61.82%), Postives = 80/110 (72.73%), Query Frame = 0
BLAST of Spg017745 vs. NCBI nr
Match: XP_022975710.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 132.5 bits (332), Expect = 2.7e-27 Identity = 69/115 (60.00%), Postives = 81/115 (70.43%), Query Frame = 0
BLAST of Spg017745 vs. NCBI nr
Match: XP_022936218.1 (cysteine proteinase inhibitor 8-like [Cucurbita moschata]) HSP 1 Score: 132.5 bits (332), Expect = 2.7e-27 Identity = 71/116 (61.21%), Postives = 88/116 (75.86%), Query Frame = 0
BLAST of Spg017745 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 72.0 bits (175), Expect = 5.8e-12 Identity = 37/88 (42.05%), Postives = 50/88 (56.82%), Query Frame = 0
BLAST of Spg017745 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 2.2e-11 Identity = 36/88 (40.91%), Postives = 50/88 (56.82%), Query Frame = 0
BLAST of Spg017745 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 70.1 bits (170), Expect = 2.2e-11 Identity = 39/75 (52.00%), Postives = 50/75 (66.67%), Query Frame = 0
BLAST of Spg017745 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 1.1e-10 Identity = 38/86 (44.19%), Postives = 55/86 (63.95%), Query Frame = 0
BLAST of Spg017745 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 7.8e-09 Identity = 35/87 (40.23%), Postives = 53/87 (60.92%), Query Frame = 0
BLAST of Spg017745 vs. ExPASy TrEMBL
Match: A0A6J1IHH5 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475753 PE=4 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 1.3e-27 Identity = 69/115 (60.00%), Postives = 81/115 (70.43%), Query Frame = 0
BLAST of Spg017745 vs. ExPASy TrEMBL
Match: A0A6J1FCN5 (cysteine proteinase inhibitor 8-like OS=Cucurbita moschata OX=3662 GN=LOC111442890 PE=4 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 1.3e-27 Identity = 71/116 (61.21%), Postives = 88/116 (75.86%), Query Frame = 0
BLAST of Spg017745 vs. ExPASy TrEMBL
Match: A0A6J1FCN1 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111442885 PE=4 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 5.0e-27 Identity = 67/110 (60.91%), Postives = 78/110 (70.91%), Query Frame = 0
BLAST of Spg017745 vs. ExPASy TrEMBL
Match: A0A6J1IDU0 (cysteine proteinase inhibitor 8-like OS=Cucurbita maxima OX=3661 GN=LOC111475783 PE=4 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 1.9e-26 Identity = 69/116 (59.48%), Postives = 87/116 (75.00%), Query Frame = 0
BLAST of Spg017745 vs. ExPASy TrEMBL
Match: A0A6J1DHK4 (cysteine proteinase inhibitor 1-like OS=Momordica charantia OX=3673 GN=LOC111021157 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 1.2e-25 Identity = 65/111 (58.56%), Postives = 77/111 (69.37%), Query Frame = 0
BLAST of Spg017745 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 70.1 bits (170), Expect = 1.6e-12 Identity = 39/75 (52.00%), Postives = 50/75 (66.67%), Query Frame = 0
BLAST of Spg017745 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 54.3 bits (129), Expect = 8.8e-08 Identity = 33/87 (37.93%), Postives = 47/87 (54.02%), Query Frame = 0
BLAST of Spg017745 vs. TAIR 10
Match: AT5G12140.1 (cystatin-1 ) HSP 1 Score: 43.5 bits (101), Expect = 1.6e-04 Identity = 29/86 (33.72%), Postives = 42/86 (48.84%), Query Frame = 0
BLAST of Spg017745 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 42.7 bits (99), Expect = 2.7e-04 Identity = 21/58 (36.21%), Postives = 30/58 (51.72%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|