Sed0014798 (gene) Chayote v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGAAGTCCAGAAATCCACTCTACTCCAAACCCCCAAAGTCCTCCAAAGAACTTCCTTGCCAGGCCGCCACCGCCGCCACAGCCGGCGGCTCCCTCCTTATTCTCTCCGGCCTCATCATGGCCACCGCCGTCATTGGGCTGACCGTCGCTCCCCCATTGTTCGTCATATTCAGCCCAGTTCTGATCCCGGCAGCAATAGTGGTGGCGCTAGTGATTGCCGGGTTCTTGGCATCCGGCGGTTTACCGGTACATGGCCGGAAAACGGCTGGATACTGGATATCGGCGGGAATCCGGCGAGGACTTGCCGCATAAAGGTCAGTATAGATTTGGCGGTAAAGGGAGAGAAGTTTAA ATGGCGAAGTCCAGAAATCCACTCTACTCCAAACCCCCAAAGTCCTCCAAAGAACTTCCTTGCCAGGCCGCCACCGCCGCCACAGCCGGCGGCTCCCTCCTTATTCTCTCCGGCCTCATCATGGCCACCGCCGTCATTGGGCTGACCGTCGCTCCCCCATTGTTCGTCATATTCAGCCCAGTTCTGATCCCGGCAGCAATAGTGGTGGCGCTAGTGATTGCCGGGTTCTTGGCATCCGGCGGTTTACCGGACTTGCCGCATAAAGGTCAGTATAGATTTGGCGGTAAAGGGAGAGAAGTTTAA ATGGCGAAGTCCAGAAATCCACTCTACTCCAAACCCCCAAAGTCCTCCAAAGAACTTCCTTGCCAGGCCGCCACCGCCGCCACAGCCGGCGGCTCCCTCCTTATTCTCTCCGGCCTCATCATGGCCACCGCCGTCATTGGGCTGACCGTCGCTCCCCCATTGTTCGTCATATTCAGCCCAGTTCTGATCCCGGCAGCAATAGTGGTGGCGCTAGTGATTGCCGGGTTCTTGGCATCCGGCGGTTTACCGGACTTGCCGCATAAAGGTCAGTATAGATTTGGCGGTAAAGGGAGAGAAGTTTAA MAKSRNPLYSKPPKSSKELPCQAATAATAGGSLLILSGLIMATAVIGLTVAPPLFVIFSPVLIPAAIVVALVIAGFLASGGLPDLPHKGQYRFGGKGREV Homology
BLAST of Sed0014798 vs. NCBI nr
Match: XP_022159524.1 (oleosin 1-like [Momordica charantia]) HSP 1 Score: 89.0 bits (219), Expect = 2.6e-14 Identity = 61/125 (48.80%), Postives = 72/125 (57.60%), Query Frame = 0
BLAST of Sed0014798 vs. NCBI nr
Match: KAG6605647.1 (Oleosin 14.9 kDa, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 88.2 bits (217), Expect = 4.4e-14 Identity = 63/128 (49.22%), Postives = 73/128 (57.03%), Query Frame = 0
BLAST of Sed0014798 vs. NCBI nr
Match: KAG7035557.1 (Oleosin 14.9 kDa, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 88.2 bits (217), Expect = 4.4e-14 Identity = 63/128 (49.22%), Postives = 73/128 (57.03%), Query Frame = 0
BLAST of Sed0014798 vs. NCBI nr
Match: XP_023533015.1 (oleosin 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 85.5 bits (210), Expect = 2.8e-13 Identity = 62/128 (48.44%), Postives = 72/128 (56.25%), Query Frame = 0
BLAST of Sed0014798 vs. NCBI nr
Match: XP_041021938.1 (oleosin 1-like [Juglans microcarpa x Juglans regia]) HSP 1 Score: 82.0 bits (201), Expect = 3.1e-12 Identity = 48/60 (80.00%), Postives = 53/60 (88.33%), Query Frame = 0
BLAST of Sed0014798 vs. ExPASy Swiss-Prot
Match: Q43284 (Oleosin 14.9 kDa OS=Arabidopsis thaliana OX=3702 GN=OL3 PE=2 SV=2) HSP 1 Score: 76.3 bits (186), Expect = 2.3e-13 Identity = 48/78 (61.54%), Postives = 58/78 (74.36%), Query Frame = 0
BLAST of Sed0014798 vs. ExPASy Swiss-Prot
Match: Q96543 (Oleosin 16 kDa OS=Bromus secalinus OX=4502 GN=OLE16 PE=2 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 3.9e-13 Identity = 44/61 (72.13%), Postives = 53/61 (86.89%), Query Frame = 0
BLAST of Sed0014798 vs. ExPASy Swiss-Prot
Match: P13436 (Oleosin Zm-I OS=Zea mays OX=4577 GN=OLE16 PE=2 SV=2) HSP 1 Score: 74.3 bits (181), Expect = 8.6e-13 Identity = 43/61 (70.49%), Postives = 52/61 (85.25%), Query Frame = 0
BLAST of Sed0014798 vs. ExPASy Swiss-Prot
Match: Q43804 (Oleosin 1 OS=Prunus dulcis OX=3755 GN=OLE1 PE=2 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.1e-12 Identity = 42/60 (70.00%), Postives = 49/60 (81.67%), Query Frame = 0
BLAST of Sed0014798 vs. ExPASy Swiss-Prot
Match: Q42980 (Oleosin 16 kDa OS=Oryza sativa subsp. japonica OX=39947 GN=OLE16 PE=2 SV=3) HSP 1 Score: 73.6 bits (179), Expect = 1.5e-12 Identity = 42/61 (68.85%), Postives = 51/61 (83.61%), Query Frame = 0
BLAST of Sed0014798 vs. ExPASy TrEMBL
Match: A0A6J1E2L5 (Oleosin OS=Momordica charantia OX=3673 GN=LOC111025916 PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 1.2e-14 Identity = 61/125 (48.80%), Postives = 72/125 (57.60%), Query Frame = 0
BLAST of Sed0014798 vs. ExPASy TrEMBL
Match: A0A6A1UUY1 (Oleosin 1 OS=Morella rubra OX=262757 GN=CJ030_MR8G004027 PE=3 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 3.4e-12 Identity = 46/60 (76.67%), Postives = 52/60 (86.67%), Query Frame = 0
BLAST of Sed0014798 vs. ExPASy TrEMBL
Match: G8H6H9 (Oleosin OS=Juglans regia OX=51240 GN=LOC108983309 PE=2 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 3.4e-12 Identity = 47/60 (78.33%), Postives = 52/60 (86.67%), Query Frame = 0
BLAST of Sed0014798 vs. ExPASy TrEMBL
Match: A0A5N6R9T3 (Oleosin OS=Carpinus fangiana OX=176857 GN=FH972_013591 PE=3 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 3.4e-12 Identity = 46/60 (76.67%), Postives = 53/60 (88.33%), Query Frame = 0
BLAST of Sed0014798 vs. ExPASy TrEMBL
Match: A0A0A0KRH1 (Oleosin-like protein OS=Cucumis sativus OX=3659 GN=Csa_5G167130 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 4.4e-12 Identity = 62/140 (44.29%), Postives = 72/140 (51.43%), Query Frame = 0
BLAST of Sed0014798 vs. TAIR 10
Match: AT5G51210.1 (oleosin3 ) HSP 1 Score: 76.3 bits (186), Expect = 1.6e-14 Identity = 48/78 (61.54%), Postives = 58/78 (74.36%), Query Frame = 0
BLAST of Sed0014798 vs. TAIR 10
Match: AT4G25140.1 (oleosin 1 ) HSP 1 Score: 69.7 bits (169), Expect = 1.5e-12 Identity = 45/73 (61.64%), Postives = 53/73 (72.60%), Query Frame = 0
BLAST of Sed0014798 vs. TAIR 10
Match: AT2G25890.1 (Oleosin family protein ) HSP 1 Score: 60.1 bits (144), Expect = 1.2e-09 Identity = 36/57 (63.16%), Postives = 42/57 (73.68%), Query Frame = 0
BLAST of Sed0014798 vs. TAIR 10
Match: AT5G40420.1 (oleosin 2 ) HSP 1 Score: 57.8 bits (138), Expect = 5.9e-09 Identity = 31/50 (62.00%), Postives = 42/50 (84.00%), Query Frame = 0
BLAST of Sed0014798 vs. TAIR 10
Match: AT3G01570.1 (Oleosin family protein ) HSP 1 Score: 57.4 bits (137), Expect = 7.7e-09 Identity = 31/53 (58.49%), Postives = 43/53 (81.13%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Chayote (edule) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|