PI0007828 (gene) Melon (PI 482460) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAAGAGAATAAGAATAGGGATTCTGTTGATTGGATTTATAATTATGATGATGGGATTTGGAATTGGAAATGGAGAAACAGAATGCGATTTATACAGCGGGAAATGGGAATCGGATTCTTCGTATCCCATCTATAATTCATCGGAATGTCCATTCATAAGGAAAGAATTTGATTGTATCAAATATGGCCGTCCAGATCGTCTTTATCTTCACTTCAGATGGCAACCAATTCACTGTGATCTCCCCAGGTTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTACAATTTCAAATTTATTGAGGGTAATTTAGTCATTTTTAGTGTTGTTTTTTAATTGTATTAAAAAGAGGACTATCATTGGATTTCCTTTTTTCTTTTGGAAAAAATAGACTCGTTTCTATTTGGTTTAGAGATGAAAACAAGGTCCGATGGAGTTGA ATGGAGAAGAGAATAAGAATAGGGATTCTGTTGATTGGATTTATAATTATGATGATGGGATTTGGAATTGGAAATGGAGAAACAGAATGCGATTTATACAGCGGGAAATGGGAATCGGATTCTTCGTATCCCATCTATAATTCATCGGAATGTCCATTCATAAGGAAAGAATTTGATTGTATCAAATATGGCCGTCCAGATCGTCTTTATCTTCACTTCAGATGGCAACCAATTCACTGTGATCTCCCCAGACTCGTTTCTATTTGGTTTAGAGATGAAAACAAGGTCCGATGGAGTTGA ATGGAGAAGAGAATAAGAATAGGGATTCTGTTGATTGGATTTATAATTATGATGATGGGATTTGGAATTGGAAATGGAGAAACAGAATGCGATTTATACAGCGGGAAATGGGAATCGGATTCTTCGTATCCCATCTATAATTCATCGGAATGTCCATTCATAAGGAAAGAATTTGATTGTATCAAATATGGCCGTCCAGATCGTCTTTATCTTCACTTCAGATGGCAACCAATTCACTGTGATCTCCCCAGACTCGTTTCTATTTGGTTTAGAGATGAAAACAAGGTCCGATGGAGTTGA MEKRIRIGILLIGFIIMMMGFGIGNGETECDLYSGKWESDSSYPIYNSSECPFIRKEFDCIKYGRPDRLYLHFRWQPIHCDLPRLVSIWFRDENKVRWS Homology
BLAST of PI0007828 vs. ExPASy Swiss-Prot
Match: F4IWA8 (Protein trichome birefringence-like 41 OS=Arabidopsis thaliana OX=3702 GN=TBL41 PE=2 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.6e-17 Identity = 37/86 (43.02%), Postives = 54/86 (62.79%), Query Frame = 0
BLAST of PI0007828 vs. ExPASy Swiss-Prot
Match: Q5BPJ0 (Protein trichome birefringence-like 11 OS=Arabidopsis thaliana OX=3702 GN=TBL11 PE=2 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 4.8e-16 Identity = 35/61 (57.38%), Postives = 43/61 (70.49%), Query Frame = 0
BLAST of PI0007828 vs. ExPASy Swiss-Prot
Match: Q8VY22 (Protein trichome birefringence-like 38 OS=Arabidopsis thaliana OX=3702 GN=TBL38 PE=2 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 6.3e-16 Identity = 31/55 (56.36%), Postives = 43/55 (78.18%), Query Frame = 0
BLAST of PI0007828 vs. ExPASy Swiss-Prot
Match: F4I037 (Protein trichome berefringence-like 7 OS=Arabidopsis thaliana OX=3702 GN=TBL7 PE=3 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 6.3e-16 Identity = 31/59 (52.54%), Postives = 43/59 (72.88%), Query Frame = 0
BLAST of PI0007828 vs. ExPASy Swiss-Prot
Match: O22960 (Protein trichome birefringence-like 37 OS=Arabidopsis thaliana OX=3702 GN=TBL37 PE=2 SV=2) HSP 1 Score: 83.6 bits (205), Expect = 1.4e-15 Identity = 31/55 (56.36%), Postives = 42/55 (76.36%), Query Frame = 0
BLAST of PI0007828 vs. ExPASy TrEMBL
Match: A0A1S3AV77 (protein trichome birefringence-like 38 OS=Cucumis melo OX=3656 GN=LOC103483016 PE=3 SV=1) HSP 1 Score: 165.2 bits (417), Expect = 1.4e-37 Identity = 75/84 (89.29%), Postives = 79/84 (94.05%), Query Frame = 0
BLAST of PI0007828 vs. ExPASy TrEMBL
Match: A0A6J1JYL5 (protein trichome birefringence-like 41 OS=Cucurbita maxima OX=3661 GN=LOC111489471 PE=3 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 3.8e-24 Identity = 52/78 (66.67%), Postives = 60/78 (76.92%), Query Frame = 0
BLAST of PI0007828 vs. ExPASy TrEMBL
Match: A0A6J1DUA2 (protein trichome birefringence-like 38 OS=Momordica charantia OX=3673 GN=LOC111024497 PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 5.0e-24 Identity = 51/80 (63.75%), Postives = 64/80 (80.00%), Query Frame = 0
BLAST of PI0007828 vs. ExPASy TrEMBL
Match: A0A6J1FER0 (protein trichome birefringence-like 41 OS=Cucurbita moschata OX=3662 GN=LOC111445049 PE=3 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 5.0e-24 Identity = 51/78 (65.38%), Postives = 60/78 (76.92%), Query Frame = 0
BLAST of PI0007828 vs. ExPASy TrEMBL
Match: A0A067L8Q8 (PMR5N domain-containing protein OS=Jatropha curcas OX=180498 GN=JCGZ_24498 PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 1.2e-20 Identity = 42/60 (70.00%), Postives = 48/60 (80.00%), Query Frame = 0
BLAST of PI0007828 vs. NCBI nr
Match: XP_008437676.1 (PREDICTED: protein trichome birefringence-like 38 [Cucumis melo]) HSP 1 Score: 165.2 bits (417), Expect = 2.8e-37 Identity = 75/84 (89.29%), Postives = 79/84 (94.05%), Query Frame = 0
BLAST of PI0007828 vs. NCBI nr
Match: KAE8648461.1 (hypothetical protein Csa_008991 [Cucumis sativus]) HSP 1 Score: 161.4 bits (407), Expect = 4.0e-36 Identity = 72/84 (85.71%), Postives = 75/84 (89.29%), Query Frame = 0
BLAST of PI0007828 vs. NCBI nr
Match: XP_031741994.1 (protein trichome birefringence-like 38 [Cucumis sativus]) HSP 1 Score: 161.4 bits (407), Expect = 4.0e-36 Identity = 72/84 (85.71%), Postives = 75/84 (89.29%), Query Frame = 0
BLAST of PI0007828 vs. NCBI nr
Match: XP_038875887.1 (protein trichome birefringence-like 38 [Benincasa hispida]) HSP 1 Score: 140.6 bits (353), Expect = 7.4e-30 Identity = 64/84 (76.19%), Postives = 71/84 (84.52%), Query Frame = 0
BLAST of PI0007828 vs. NCBI nr
Match: XP_022993470.1 (protein trichome birefringence-like 41 [Cucurbita maxima]) HSP 1 Score: 120.6 bits (301), Expect = 7.9e-24 Identity = 52/78 (66.67%), Postives = 60/78 (76.92%), Query Frame = 0
BLAST of PI0007828 vs. TAIR 10
Match: AT3G14850.2 (TRICHOME BIREFRINGENCE-LIKE 41 ) HSP 1 Score: 89.4 bits (220), Expect = 1.8e-18 Identity = 37/86 (43.02%), Postives = 54/86 (62.79%), Query Frame = 0
BLAST of PI0007828 vs. TAIR 10
Match: AT5G19160.1 (TRICHOME BIREFRINGENCE-LIKE 11 ) HSP 1 Score: 85.1 bits (209), Expect = 3.4e-17 Identity = 35/61 (57.38%), Postives = 43/61 (70.49%), Query Frame = 0
BLAST of PI0007828 vs. TAIR 10
Match: AT1G29050.1 (TRICHOME BIREFRINGENCE-LIKE 38 ) HSP 1 Score: 84.7 bits (208), Expect = 4.5e-17 Identity = 31/55 (56.36%), Postives = 43/55 (78.18%), Query Frame = 0
BLAST of PI0007828 vs. TAIR 10
Match: AT1G48880.1 (TRICHOME BIREFRINGENCE-LIKE 7 ) HSP 1 Score: 84.7 bits (208), Expect = 4.5e-17 Identity = 31/59 (52.54%), Postives = 43/59 (72.88%), Query Frame = 0
BLAST of PI0007828 vs. TAIR 10
Match: AT2G34070.1 (TRICHOME BIREFRINGENCE-LIKE 37 ) HSP 1 Score: 83.6 bits (205), Expect = 1.0e-16 Identity = 31/55 (56.36%), Postives = 42/55 (76.36%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (PI 482460) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|