
MELO3C025165 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGGTAAGGAAGAAGATGTTCGATTGGGAGCTAACAGGTTCACAGAGAGGCAGCCCATTGGGACGGCGGCGCAGAGCCAAGACGATGCCAAGGACTACAAGGAGCCACCACCGGCTCCTCTCTTCGAGCCAGAGGAGCTCACTTCATGGTCTTTTTACAGAGCTGGAATCGCCGAGTTTTTCGCTACTTTTCTATTCCTTTACATCACCGTTTTGACTGTCATGGGTGTCGTCCGGTCCAATGAAGCGGATGGTAATACCT ATGGAGGGTAAGGAAGAAGATGTTCGATTGGGAGCTAACAGGTTCACAGAGAGGCAGCCCATTGGGACGGCGGCGCAGAGCCAAGACGATGCCAAGGACTACAAGGAGCCACCACCGGCTCCTCTCTTCGAGCCAGAGGAGCTCACTTCATGGTCTTTTTACAGAGCTGGAATCGCCGAGTTTTTCGCTACTTTTCTATTCCTTTACATCACCGTTTTGACTGTCATGGGTGTCGTCCGGTCCAATGAAGCGGATGGTAATACCT ATGGAGGGTAAGGAAGAAGATGTTCGATTGGGAGCTAACAGGTTCACAGAGAGGCAGCCCATTGGGACGGCGGCGCAGAGCCAAGACGATGCCAAGGACTACAAGGAGCCACCACCGGCTCCTCTCTTCGAGCCAGAGGAGCTCACTTCATGGTCTTTTTACAGAGCTGGAATCGCCGAGTTTTTCGCTACTTTTCTATTCCTTTACATCACCGTTTTGACTGTCATGGGTGTCGTCCGGTCCAATGAAGCGGATGGTAATACC MEGKEEDVRLGANRFTERQPIGTAAQSQDDAKDYKEPPPAPLFEPEELTSWSFYRAGIAEFFATFLFLYITVLTVMGVVRSNEADGNT Homology
BLAST of MELO3C025165 vs. NCBI nr
Match: KAA0037378.1 (putative aquaporin PIP1-4 [Cucumis melo var. makuwa] >TYJ97533.1 putative aquaporin PIP1-4 [Cucumis melo var. makuwa]) HSP 1 Score: 177.6 bits (449), Expect = 4.8e-41 Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 0
BLAST of MELO3C025165 vs. NCBI nr
Match: KAA0037382.1 (putative aquaporin PIP1-4 [Cucumis melo var. makuwa] >TYJ97529.1 putative aquaporin PIP1-4 [Cucumis melo var. makuwa]) HSP 1 Score: 172.9 bits (437), Expect = 1.2e-39 Identity = 85/88 (96.59%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of MELO3C025165 vs. NCBI nr
Match: XP_022996242.1 (probable aquaporin PIP1-4 [Cucurbita maxima]) HSP 1 Score: 172.6 bits (436), Expect = 1.6e-39 Identity = 85/88 (96.59%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of MELO3C025165 vs. NCBI nr
Match: XP_022942456.1 (probable aquaporin PIP1-4 [Cucurbita moschata] >XP_023540996.1 probable aquaporin PIP1-4 [Cucurbita pepo subsp. pepo] >KAG6600009.1 putative aquaporin PIP1-4, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 172.6 bits (436), Expect = 1.6e-39 Identity = 85/88 (96.59%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of MELO3C025165 vs. NCBI nr
Match: KGN50639.1 (hypothetical protein Csa_021422 [Cucumis sativus]) HSP 1 Score: 171.4 bits (433), Expect = 3.5e-39 Identity = 85/88 (96.59%), Postives = 85/88 (96.59%), Query Frame = 0
BLAST of MELO3C025165 vs. ExPASy Swiss-Prot
Match: Q6EU94 (Aquaporin PIP1-1 OS=Oryza sativa subsp. japonica OX=39947 GN=PIP1-1 PE=2 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 1.9e-32 Identity = 69/82 (84.15%), Postives = 74/82 (90.24%), Query Frame = 0
BLAST of MELO3C025165 vs. ExPASy Swiss-Prot
Match: P25794 (Probable aquaporin PIP-type 7a OS=Pisum sativum OX=3888 GN=TRG-31 PE=2 SV=2) HSP 1 Score: 139.4 bits (350), Expect = 1.9e-32 Identity = 68/82 (82.93%), Postives = 74/82 (90.24%), Query Frame = 0
BLAST of MELO3C025165 vs. ExPASy Swiss-Prot
Match: Q9XF59 (Aquaporin PIP1-2 OS=Zea mays OX=4577 GN=PIP1-2 PE=1 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 4.3e-32 Identity = 69/81 (85.19%), Postives = 73/81 (90.12%), Query Frame = 0
BLAST of MELO3C025165 vs. ExPASy Swiss-Prot
Match: Q7XSQ9 (Probable aquaporin PIP1-2 OS=Oryza sativa subsp. japonica OX=39947 GN=PIP1-2 PE=2 SV=3) HSP 1 Score: 137.5 bits (345), Expect = 7.3e-32 Identity = 71/81 (87.65%), Postives = 73/81 (90.12%), Query Frame = 0
BLAST of MELO3C025165 vs. ExPASy Swiss-Prot
Match: Q9AQU5 (Aquaporin PIP1-3/PIP1-4 OS=Zea mays OX=4577 GN=PIP1-3 PE=2 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 1.6e-31 Identity = 71/84 (84.52%), Postives = 75/84 (89.29%), Query Frame = 0
BLAST of MELO3C025165 vs. ExPASy TrEMBL
Match: A0A5D3BDZ5 (Putative aquaporin PIP1-4 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold85G00460 PE=3 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 2.3e-41 Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 0
BLAST of MELO3C025165 vs. ExPASy TrEMBL
Match: A0A5D3BER1 (Putative aquaporin PIP1-4 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold85G00410 PE=3 SV=1) HSP 1 Score: 172.9 bits (437), Expect = 5.8e-40 Identity = 85/88 (96.59%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of MELO3C025165 vs. ExPASy TrEMBL
Match: A0A6J1K1D6 (probable aquaporin PIP1-4 OS=Cucurbita maxima OX=3661 GN=LOC111491522 PE=3 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 7.5e-40 Identity = 85/88 (96.59%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of MELO3C025165 vs. ExPASy TrEMBL
Match: A0A6J1FNW9 (probable aquaporin PIP1-4 OS=Cucurbita moschata OX=3662 GN=LOC111447489 PE=3 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 7.5e-40 Identity = 85/88 (96.59%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of MELO3C025165 vs. ExPASy TrEMBL
Match: A0A0A0KP30 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G199270 PE=3 SV=1) HSP 1 Score: 171.4 bits (433), Expect = 1.7e-39 Identity = 85/88 (96.59%), Postives = 85/88 (96.59%), Query Frame = 0
BLAST of MELO3C025165 vs. TAIR 10
Match: AT4G00430.2 (plasma membrane intrinsic protein 1;4 ) HSP 1 Score: 135.2 bits (339), Expect = 2.6e-32 Identity = 69/81 (85.19%), Postives = 74/81 (91.36%), Query Frame = 0
BLAST of MELO3C025165 vs. TAIR 10
Match: AT4G00430.1 (plasma membrane intrinsic protein 1;4 ) HSP 1 Score: 135.2 bits (339), Expect = 2.6e-32 Identity = 69/81 (85.19%), Postives = 74/81 (91.36%), Query Frame = 0
BLAST of MELO3C025165 vs. TAIR 10
Match: AT2G45960.1 (plasma membrane intrinsic protein 1B ) HSP 1 Score: 131.7 bits (330), Expect = 2.8e-31 Identity = 68/81 (83.95%), Postives = 72/81 (88.89%), Query Frame = 0
BLAST of MELO3C025165 vs. TAIR 10
Match: AT2G45960.2 (plasma membrane intrinsic protein 1B ) HSP 1 Score: 131.7 bits (330), Expect = 2.8e-31 Identity = 68/81 (83.95%), Postives = 72/81 (88.89%), Query Frame = 0
BLAST of MELO3C025165 vs. TAIR 10
Match: AT2G45960.3 (plasma membrane intrinsic protein 1B ) HSP 1 Score: 131.7 bits (330), Expect = 2.8e-31 Identity = 68/81 (83.95%), Postives = 72/81 (88.89%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|