MELO.jh015191.1 (gene) Melon (Harukei-3) v1.41
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptidestart_codonstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATTAGTAGATTGTGTATCATGTATATACGTTTTCAAATTCATAACTATTTAATAAAAAAGAATGTTGATTAGATCAAAATTGAAAGTCACCAATAATTTTCGTTTATCATGGGTAAGGACACTATTGCTAACATAATAACCTCTATTCGTAATGCTGACATGAATAGAAAAGGAATGGTTCAAATACCATCTACTAACATCACCGAAAACATTGTGAAAAACTTTTACGAGAAGGTTTTATTGAAAACTTAAGGAAACATTGGGAAAACAACAAGGATTTTTAGGTTTGAACCCTACAACATAGAAGAAATAAGAAAGGA ATTAGTAGATTGTGTATCATGTATATACGTTTTCAAATTCATAACTATTTAATAAAAAAGAATGTTGATTAGATCAAAATTGAAAGTCACCAATAATTTTCGTTTATCATGGGTAAGGACACTATTGCTAACATAATAACCTCTATTCGTAATGCTGACATGAATAGAAAAGGAATGGTTCAAATACCATCTACTAACATCACCGAAAACATTGTGAAAAACTTTTACGAGAAGGTTTTATTGAAAACTTAAGGAAACATTGGGAAAACAACAAGGATTTTTAGGTTTGAACCCTACAACATAGAAGAAATAAGAAAGGA ATGGGTAAGGACACTATTGCTAACATAATAACCTCTATTCGTAATGCTGACATGAATAGAAAAGGAATGGTTCAAATACCATCTACTAACATCACCGAAAACATTGTGAAAAACTTTTACGAGAAGGTTTTATTGAAAACTTAA MGKDTIANIITSIRNADMNRKGMVQIPSTNITENIVKNFYEKVLLKT Homology
BLAST of MELO.jh015191.1 vs. NCBI nr
Match: YP_009431592.1 (ribosomal protein S8 [Citrullus amarus] >APW82498.1 ribosomal protein S8 [Citrullus lanatus subsp. vulgaris] >APW82583.1 ribosomal protein S8 [Citrullus lanatus subsp. vulgaris] >ASY96178.1 ribosomal protein S8 [Citrullus amarus]) HSP 1 Score: 72.4 bits (176), Expect = 1.46e-14 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO.jh015191.1 vs. NCBI nr
Match: YP_009525221.1 (ribosomal protein S8 [Hodgsonia macrocarpa] >YP_009560871.1 ribosomal protein S8 [Trichosanthes kirilowii] >YP_009674426.1 ribosomal protein S8 [Siraitia grosvenorii] >YP_009738237.1 ribosomal protein S8 [Siraitia siamensis] >YP_009751941.1 ribosomal protein S8 [Cyclanthera pedata] >YP_009752362.1 ribosomal protein S8 [Bryonia marmorata] >YP_009752447.1 ribosomal protein S8 [Trichosanthes tricuspidata] >YP_009753293.1 ribosomal protein S8 [Nothoalsomitra suberosa] >YP_009753655.1 ribosomal protein S8 [Trichosanthes wallichiana] >QIT04085.1 ribosomal protein S8 [Luffa aegyptiaca] >QKX48510.1 ribosomal protein S8 [Luffa acutangula] >AXR94584.1 ribosomal protein S8 [Hodgsonia macrocarpa] >AXR94670.1 ribosomal protein S8 [Hodgsonia macrocarpa] >AXR94753.1 ribosomal protein S8 [Hodgsonia macrocarpa]) HSP 1 Score: 72.4 bits (176), Expect = 1.46e-14 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO.jh015191.1 vs. NCBI nr
Match: YP_009236314.1 (ribosomal protein S8 [Gynostemma pentaphyllum] >YP_009440192.1 ribosomal protein S8 [Gynostemma longipes] >YP_009440279.1 ribosomal protein S8 [Gynostemma burmanicum (nom. inval.)] >YP_009440366.1 ribosomal protein S8 [Gynostemma pubescens] >AMF84028.1 ribosomal protein S8 [Gynostemma pentaphyllum] >ANI25219.1 ribosomal protein S8 [Gynostemma pentaphyllum] >ART65011.1 ribosomal protein S8 [Gynostemma pentaphyllum] >ATG86939.1 ribosomal protein S8 [Gynostemma longipes] >ATG87026.1 ribosomal protein S8 [Gynostemma burmanicum (nom. inval.)]) HSP 1 Score: 72.4 bits (176), Expect = 1.46e-14 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO.jh015191.1 vs. NCBI nr
Match: AHM91246.1 (ribosomal protein S8 [Lagenaria siceraria]) HSP 1 Score: 72.4 bits (176), Expect = 1.46e-14 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO.jh015191.1 vs. NCBI nr
Match: QZL38629.1 (ribosomal protein S8 [Citrullus naudinianus]) HSP 1 Score: 72.4 bits (176), Expect = 1.46e-14 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO.jh015191.1 vs. ExPASy Swiss-Prot
Match: Q4VZK0 (30S ribosomal protein S8, chloroplastic OS=Cucumis sativus OX=3659 GN=rps8 PE=3 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 3.4e-12 Identity = 35/37 (94.59%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO.jh015191.1 vs. ExPASy Swiss-Prot
Match: Q2PMQ0 (30S ribosomal protein S8, chloroplastic OS=Glycine max OX=3847 GN=rps8 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.1e-10 Identity = 33/37 (89.19%), Postives = 35/37 (94.59%), Query Frame = 0
BLAST of MELO.jh015191.1 vs. ExPASy Swiss-Prot
Match: Q2L942 (30S ribosomal protein S8, chloroplastic OS=Gossypium hirsutum OX=3635 GN=rps8 PE=3 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 1.4e-10 Identity = 33/37 (89.19%), Postives = 35/37 (94.59%), Query Frame = 0
BLAST of MELO.jh015191.1 vs. ExPASy Swiss-Prot
Match: A4QL54 (30S ribosomal protein S8, chloroplastic OS=Draba nemorosa OX=171822 GN=rps8 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 1.9e-10 Identity = 33/37 (89.19%), Postives = 36/37 (97.30%), Query Frame = 0
BLAST of MELO.jh015191.1 vs. ExPASy Swiss-Prot
Match: Q49KW3 (30S ribosomal protein S8, chloroplastic OS=Eucalyptus globulus subsp. globulus OX=71271 GN=rps8 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 1.9e-10 Identity = 33/46 (71.74%), Postives = 38/46 (82.61%), Query Frame = 0
BLAST of MELO.jh015191.1 vs. ExPASy TrEMBL
Match: A0A6H0ETL0 (30S ribosomal protein S8, chloroplastic OS=Trichosanthes kirilowii OX=3677 GN=rps8 PE=3 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 7.09e-15 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO.jh015191.1 vs. ExPASy TrEMBL
Match: A0A249RZ88 (30S ribosomal protein S8, chloroplastic OS=Cucumis melo var. cantalupensis OX=3658 GN=rps8 PE=3 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 7.09e-15 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO.jh015191.1 vs. ExPASy TrEMBL
Match: A0A1S4EU50 (30S ribosomal protein S8, chloroplastic OS=Cucumis melo OX=3656 GN=rps8 PE=3 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 7.09e-15 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO.jh015191.1 vs. ExPASy TrEMBL
Match: A0A109WXX2 (30S ribosomal protein S8, chloroplastic OS=Gynostemma pentaphyllum OX=182084 GN=rps8 PE=3 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 7.09e-15 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO.jh015191.1 vs. ExPASy TrEMBL
Match: A0A1P8LE42 (Ribosomal protein S8 OS=Citrullus mucosospermus OX=519315 GN=rps8 PE=3 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 7.09e-15 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO.jh015191.1 vs. TAIR 10
Match: ATCG00770.1 (ribosomal protein S8 ) HSP 1 Score: 62.8 bits (151), Expect = 8.6e-11 Identity = 32/37 (86.49%), Postives = 35/37 (94.59%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Harukei-3) v1.41
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|