
MC11g1017 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGGCTGTTCTGTTCTTGGCTCTGCTTCTGTCCGGCGCCGAGGCGTCCCCCTTGTGCAAGATCGACACCAAGGACCTCGCCGTGTGCCGGCCCGCGGTGACCACGGTCCCGGGCCAACCGCTGCCGCTGCCGACCGAGGCCTGCTGCGGAGTGGTCCATCGGGCCGACCTCAAGTGTCTCTGCAACCTCAAGTCTCTCCTCCCGGCCGTCGGGATCGATACTGCTAATGCTATGGCATTGCCCCCCAAATGTGGCATCCAAGCCCCACCCGAGTGTCATGTT ATGGTGGCTGTTCTGTTCTTGGCTCTGCTTCTGTCCGGCGCCGAGGCGTCCCCCTTGTGCAAGATCGACACCAAGGACCTCGCCGTGTGCCGGCCCGCGGTGACCACGGTCCCGGGCCAACCGCTGCCGCTGCCGACCGAGGCCTGCTGCGGAGTGGTCCATCGGGCCGACCTCAAGTGTCTCTGCAACCTCAAGTCTCTCCTCCCGGCCGTCGGGATCGATACTGCTAATGCTATGGCATTGCCCCCCAAATGTGGCATCCAAGCCCCACCCGAGTGTCATGTT ATGGTGGCTGTTCTGTTCTTGGCTCTGCTTCTGTCCGGCGCCGAGGCGTCCCCCTTGTGCAAGATCGACACCAAGGACCTCGCCGTGTGCCGGCCCGCGGTGACCACGGTCCCGGGCCAACCGCTGCCGCTGCCGACCGAGGCCTGCTGCGGAGTGGTCCATCGGGCCGACCTCAAGTGTCTCTGCAACCTCAAGTCTCTCCTCCCGGCCGTCGGGATCGATACTGCTAATGCTATGGCATTGCCCCCCAAATGTGGCATCCAAGCCCCACCCGAGTGTCATGTT MVAVLFLALLLSGAEASPLCKIDTKDLAVCRPAVTTVPGQPLPLPTEACCGVVHRADLKCLCNLKSLLPAVGIDTANAMALPPKCGIQAPPECHV Homology
BLAST of MC11g1017 vs. NCBI nr
Match: KAG7037349.1 (putative lipid-transfer protein DIR1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 144 bits (364), Expect = 1.11e-42 Identity = 71/96 (73.96%), Postives = 78/96 (81.25%), Query Frame = 0
BLAST of MC11g1017 vs. NCBI nr
Match: KAG6607773.1 (putative lipid-transfer protein DIR1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 125 bits (315), Expect = 2.98e-35 Identity = 57/92 (61.96%), Postives = 70/92 (76.09%), Query Frame = 0
BLAST of MC11g1017 vs. NCBI nr
Match: KAG7037350.1 (putative lipid-transfer protein DIR1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 125 bits (313), Expect = 6.77e-35 Identity = 57/92 (61.96%), Postives = 70/92 (76.09%), Query Frame = 0
BLAST of MC11g1017 vs. NCBI nr
Match: XP_008447695.1 (PREDICTED: putative lipid-transfer protein DIR1 [Cucumis melo] >KAA0048163.1 putative lipid-transfer protein DIR1 [Cucumis melo var. makuwa]) HSP 1 Score: 124 bits (312), Expect = 9.90e-35 Identity = 62/92 (67.39%), Postives = 72/92 (78.26%), Query Frame = 0
BLAST of MC11g1017 vs. NCBI nr
Match: XP_038896217.1 (putative lipid-transfer protein DIR1 [Benincasa hispida]) HSP 1 Score: 124 bits (310), Expect = 2.39e-34 Identity = 58/91 (63.74%), Postives = 70/91 (76.92%), Query Frame = 0
BLAST of MC11g1017 vs. ExPASy TrEMBL
Match: A0A0A0LAS6 (AAI domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G760500 PE=4 SV=1) HSP 1 Score: 128 bits (321), Expect = 2.04e-36 Identity = 61/91 (67.03%), Postives = 70/91 (76.92%), Query Frame = 0
BLAST of MC11g1017 vs. ExPASy TrEMBL
Match: A0A5A7TX28 (Putative lipid-transfer protein DIR1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold63G00630 PE=4 SV=1) HSP 1 Score: 124 bits (312), Expect = 4.79e-35 Identity = 62/92 (67.39%), Postives = 72/92 (78.26%), Query Frame = 0
BLAST of MC11g1017 vs. ExPASy TrEMBL
Match: A0A1S3BHE7 (putative lipid-transfer protein DIR1 OS=Cucumis melo OX=3656 GN=LOC103490109 PE=4 SV=1) HSP 1 Score: 124 bits (312), Expect = 4.79e-35 Identity = 62/92 (67.39%), Postives = 72/92 (78.26%), Query Frame = 0
BLAST of MC11g1017 vs. ExPASy TrEMBL
Match: A0A0A0LBB0 (AAI domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G759990 PE=4 SV=1) HSP 1 Score: 119 bits (299), Expect = 5.15e-33 Identity = 54/90 (60.00%), Postives = 68/90 (75.56%), Query Frame = 0
BLAST of MC11g1017 vs. ExPASy TrEMBL
Match: A0A5A7TY68 (Putative lipid-transfer protein DIR1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold63G00600 PE=4 SV=1) HSP 1 Score: 117 bits (293), Expect = 2.35e-32 Identity = 52/86 (60.47%), Postives = 65/86 (75.58%), Query Frame = 0
BLAST of MC11g1017 vs. TAIR 10
Match: AT5G55450.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 74.7 bits (182), Expect = 4.4e-14 Identity = 40/90 (44.44%), Postives = 51/90 (56.67%), Query Frame = 0
BLAST of MC11g1017 vs. TAIR 10
Match: AT5G55410.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 68.2 bits (165), Expect = 4.2e-12 Identity = 36/93 (38.71%), Postives = 51/93 (54.84%), Query Frame = 0
BLAST of MC11g1017 vs. TAIR 10
Match: AT5G55410.2 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 67.4 bits (163), Expect = 7.1e-12 Identity = 34/88 (38.64%), Postives = 49/88 (55.68%), Query Frame = 0
BLAST of MC11g1017 vs. TAIR 10
Match: AT5G55460.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 60.1 bits (144), Expect = 1.1e-09 Identity = 35/94 (37.23%), Postives = 50/94 (53.19%), Query Frame = 0
BLAST of MC11g1017 vs. TAIR 10
Match: AT3G52130.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 47.8 bits (112), Expect = 5.8e-06 Identity = 28/65 (43.08%), Postives = 33/65 (50.77%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|