
MC11g0204 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GATAAAATCAAGGGCCCATGGAGCGCCGAAGAGGATCGGATCCTGACCCGACTCGTCGAGCGTTACGGCCCGAGGAATTGGTCCTTGATTAGCCGTTATGTAAAGGGGCGGTCGGGGAAATCGTGCCGGCTCCGGTGGTGCAATCAGCTCTGCCCCGGCGTCGAGCACCGCCCCTTCTCTCCAGCCGAGGATGACGCCATCATCGCCGCCCACGCCCGCTACGGAAACCGGTGGGCCACCATTGCCCGCTTGCTGCCCGGTCGGACGGACAATGCCGTCAAGAATCACTGGAACTCCACGCTCAAGCGCCGA GATAAAATCAAGGGCCCATGGAGCGCCGAAGAGGATCGGATCCTGACCCGACTCGTCGAGCGTTACGGCCCGAGGAATTGGTCCTTGATTAGCCGTTATGTAAAGGGGCGGTCGGGGAAATCGTGCCGGCTCCGGTGGTGCAATCAGCTCTGCCCCGGCGTCGAGCACCGCCCCTTCTCTCCAGCCGAGGATGACGCCATCATCGCCGCCCACGCCCGCTACGGAAACCGGTGGGCCACCATTGCCCGCTTGCTGCCCGGTCGGACGGACAATGCCGTCAAGAATCACTGGAACTCCACGCTCAAGCGCCGA GATAAAATCAAGGGCCCATGGAGCGCCGAAGAGGATCGGATCCTGACCCGACTCGTCGAGCGTTACGGCCCGAGGAATTGGTCCTTGATTAGCCGTTATGTAAAGGGGCGGTCGGGGAAATCGTGCCGGCTCCGGTGGTGCAATCAGCTCTGCCCCGGCGTCGAGCACCGCCCCTTCTCTCCAGCCGAGGATGACGCCATCATCGCCGCCCACGCCCGCTACGGAAACCGGTGGGCCACCATTGCCCGCTTGCTGCCCGGTCGGACGGACAATGCCGTCAAGAATCACTGGAACTCCACGCTCAAGCGCCGA DKIKGPWSAEEDRILTRLVERYGPRNWSLISRYVKGRSGKSCRLRWCNQLCPGVEHRPFSPAEDDAIIAAHARYGNRWATIARLLPGRTDNAVKNHWNSTLKRR Homology
BLAST of MC11g0204 vs. ExPASy Swiss-Prot
Match: Q9SN12 (Transcription factor MYB77 OS=Arabidopsis thaliana OX=3702 GN=MYB77 PE=1 SV=1) HSP 1 Score: 180.6 bits (457), Expect = 8.9e-45 Identity = 78/104 (75.00%), Postives = 90/104 (86.54%), Query Frame = 0
BLAST of MC11g0204 vs. ExPASy Swiss-Prot
Match: O23160 (Transcription factor MYB73 OS=Arabidopsis thaliana OX=3702 GN=MYB73 PE=1 SV=1) HSP 1 Score: 177.2 bits (448), Expect = 9.8e-44 Identity = 77/104 (74.04%), Postives = 91/104 (87.50%), Query Frame = 0
BLAST of MC11g0204 vs. ExPASy Swiss-Prot
Match: Q9FDW1 (Transcription factor MYB44 OS=Arabidopsis thaliana OX=3702 GN=MYB44 PE=1 SV=1) HSP 1 Score: 176.8 bits (447), Expect = 1.3e-43 Identity = 78/104 (75.00%), Postives = 89/104 (85.58%), Query Frame = 0
BLAST of MC11g0204 vs. ExPASy Swiss-Prot
Match: Q42575 (Transcription factor MYB1 OS=Arabidopsis thaliana OX=3702 GN=MYB1 PE=2 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 5.6e-39 Identity = 70/104 (67.31%), Postives = 84/104 (80.77%), Query Frame = 0
BLAST of MC11g0204 vs. ExPASy Swiss-Prot
Match: O04192 (Transcription factor MYB25 OS=Arabidopsis thaliana OX=3702 GN=MYB25 PE=2 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 2.0e-36 Identity = 66/103 (64.08%), Postives = 83/103 (80.58%), Query Frame = 0
BLAST of MC11g0204 vs. NCBI nr
Match: XP_022139700.1 (transcription factor MYB44-like [Momordica charantia]) HSP 1 Score: 226 bits (576), Expect = 8.01e-73 Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 0
BLAST of MC11g0204 vs. NCBI nr
Match: XP_023525388.1 (transcription factor MYB44-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 224 bits (572), Expect = 1.76e-72 Identity = 102/104 (98.08%), Postives = 104/104 (100.00%), Query Frame = 0
BLAST of MC11g0204 vs. NCBI nr
Match: KAG6608498.1 (Transcription factor MYB44, partial [Cucurbita argyrosperma subsp. sororia] >KAG7037824.1 Transcription factor MYB44, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 224 bits (572), Expect = 1.76e-72 Identity = 102/104 (98.08%), Postives = 104/104 (100.00%), Query Frame = 0
BLAST of MC11g0204 vs. NCBI nr
Match: XP_022941049.1 (transcription factor MYB44-like [Cucurbita moschata]) HSP 1 Score: 224 bits (572), Expect = 1.76e-72 Identity = 102/104 (98.08%), Postives = 104/104 (100.00%), Query Frame = 0
BLAST of MC11g0204 vs. NCBI nr
Match: XP_008452503.1 (PREDICTED: transcriptional activator Myb-like [Cucumis melo] >KAA0064358.1 transcriptional activator Myb-like [Cucumis melo var. makuwa] >TYK20229.1 transcriptional activator Myb-like [Cucumis melo var. makuwa]) HSP 1 Score: 224 bits (572), Expect = 1.82e-72 Identity = 102/104 (98.08%), Postives = 104/104 (100.00%), Query Frame = 0
BLAST of MC11g0204 vs. ExPASy TrEMBL
Match: A0A6J1CD16 (transcription factor MYB44-like OS=Momordica charantia OX=3673 GN=LOC111010546 PE=4 SV=1) HSP 1 Score: 226 bits (576), Expect = 3.88e-73 Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 0
BLAST of MC11g0204 vs. ExPASy TrEMBL
Match: A0A6J1FM32 (transcription factor MYB44-like OS=Cucurbita moschata OX=3662 GN=LOC111446453 PE=4 SV=1) HSP 1 Score: 224 bits (572), Expect = 8.54e-73 Identity = 102/104 (98.08%), Postives = 104/104 (100.00%), Query Frame = 0
BLAST of MC11g0204 vs. ExPASy TrEMBL
Match: A0A5A7V9U0 (Transcriptional activator Myb-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold134G003670 PE=4 SV=1) HSP 1 Score: 224 bits (572), Expect = 8.82e-73 Identity = 102/104 (98.08%), Postives = 104/104 (100.00%), Query Frame = 0
BLAST of MC11g0204 vs. ExPASy TrEMBL
Match: A0A1S3BV53 (transcriptional activator Myb-like OS=Cucumis melo OX=3656 GN=LOC103493514 PE=4 SV=1) HSP 1 Score: 224 bits (572), Expect = 8.82e-73 Identity = 102/104 (98.08%), Postives = 104/104 (100.00%), Query Frame = 0
BLAST of MC11g0204 vs. ExPASy TrEMBL
Match: A0A0A0L4S7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G638510 PE=4 SV=1) HSP 1 Score: 224 bits (572), Expect = 9.72e-73 Identity = 102/104 (98.08%), Postives = 104/104 (100.00%), Query Frame = 0
BLAST of MC11g0204 vs. TAIR 10
Match: AT3G50060.1 (myb domain protein 77 ) HSP 1 Score: 180.6 bits (457), Expect = 6.3e-46 Identity = 78/104 (75.00%), Postives = 90/104 (86.54%), Query Frame = 0
BLAST of MC11g0204 vs. TAIR 10
Match: AT2G23290.1 (myb domain protein 70 ) HSP 1 Score: 177.6 bits (449), Expect = 5.3e-45 Identity = 78/104 (75.00%), Postives = 90/104 (86.54%), Query Frame = 0
BLAST of MC11g0204 vs. TAIR 10
Match: AT4G37260.1 (myb domain protein 73 ) HSP 1 Score: 177.2 bits (448), Expect = 7.0e-45 Identity = 77/104 (74.04%), Postives = 91/104 (87.50%), Query Frame = 0
BLAST of MC11g0204 vs. TAIR 10
Match: AT5G67300.1 (myb domain protein r1 ) HSP 1 Score: 176.8 bits (447), Expect = 9.1e-45 Identity = 78/104 (75.00%), Postives = 89/104 (85.58%), Query Frame = 0
BLAST of MC11g0204 vs. TAIR 10
Match: AT3G55730.1 (myb domain protein 109 ) HSP 1 Score: 164.9 bits (416), Expect = 3.6e-41 Identity = 71/103 (68.93%), Postives = 87/103 (84.47%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|