MC06g1083 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GGGCTGCTTACTTCCCAAACAGATCTTCCTACATCTATATATAAACGCTGGTTTATCAAGAATACGCAAGAAAAGCACTTCGGATTGTTGATTCATCGCCAGAGATGGCTTAGAACCAATAGTTCATTATCTAATGGATTTTTCCGTTCTAATACTCCATCCGAGAGTTATCAGTATTTATCAAATCTGTTCCTATCTAACGGAACGCTATTGGATCAAATGACAAAGACATTGTTGAGAAAAAGATGGCTTTTCCCGGATGAAATGAAAATTGGATTCATG GGGCTGCTTACTTCCCAAACAGATCTTCCTACATCTATATATAAACGCTGGTTTATCAAGAATACGCAAGAAAAGCACTTCGGATTGTTGATTCATCGCCAGAGATGGCTTAGAACCAATAGTTCATTATCTAATGGATTTTTCCGTTCTAATACTCCATCCGAGAGTTATCAGTATTTATCAAATCTGTTCCTATCTAACGGAACGCTATTGGATCAAATGACAAAGACATTGTTGAGAAAAAGATGGCTTTTCCCGGATGAAATGAAAATTGGATTCATG GGGCTGCTTACTTCCCAAACAGATCTTCCTACATCTATATATAAACGCTGGTTTATCAAGAATACGCAAGAAAAGCACTTCGGATTGTTGATTCATCGCCAGAGATGGCTTAGAACCAATAGTTCATTATCTAATGGATTTTTCCGTTCTAATACTCCATCCGAGAGTTATCAGTATTTATCAAATCTGTTCCTATCTAACGGAACGCTATTGGATCAAATGACAAAGACATTGTTGAGAAAAAGATGGCTTTTCCCGGATGAAATGAAAATTGGATTCATG GLLTSQTDLPTSIYKRWFIKNTQEKHFGLLIHRQRWLRTNSSLSNGFFRSNTPSESYQYLSNLFLSNGTLLDQMTKTLLRKRWLFPDEMKIGFM Homology
BLAST of MC06g1083 vs. ExPASy Swiss-Prot
Match: B1A978 (Protein Ycf2 OS=Carica papaya OX=3649 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 188.7 bits (478), Expect = 2.9e-47 Identity = 92/94 (97.87%), Postives = 92/94 (97.87%), Query Frame = 0
BLAST of MC06g1083 vs. ExPASy Swiss-Prot
Match: Q49KT6 (Protein Ycf2 OS=Eucalyptus globulus subsp. globulus OX=71271 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 186.8 bits (473), Expect = 1.1e-46 Identity = 91/94 (96.81%), Postives = 91/94 (96.81%), Query Frame = 0
BLAST of MC06g1083 vs. ExPASy Swiss-Prot
Match: Q09MB4 (Protein Ycf2 OS=Citrus sinensis OX=2711 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 186.4 bits (472), Expect = 1.5e-46 Identity = 91/94 (96.81%), Postives = 91/94 (96.81%), Query Frame = 0
BLAST of MC06g1083 vs. ExPASy Swiss-Prot
Match: A0ZZ78 (Protein Ycf2 OS=Gossypium barbadense OX=3634 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 181.4 bits (459), Expect = 4.7e-45 Identity = 91/96 (94.79%), Postives = 91/96 (94.79%), Query Frame = 0
BLAST of MC06g1083 vs. ExPASy Swiss-Prot
Match: Q2L949 (Protein Ycf2 OS=Gossypium hirsutum OX=3635 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 181.4 bits (459), Expect = 4.7e-45 Identity = 91/96 (94.79%), Postives = 91/96 (94.79%), Query Frame = 0
BLAST of MC06g1083 vs. NCBI nr
Match: TYJ39383.1 (hypothetical protein E1A91_A04G066200v1, partial [Gossypium mustelinum]) HSP 1 Score: 188 bits (477), Expect = 1.29e-59 Identity = 91/94 (96.81%), Postives = 91/94 (96.81%), Query Frame = 0
BLAST of MC06g1083 vs. NCBI nr
Match: TYJ49193.1 (hypothetical protein E1A91_A01G117000v1, partial [Gossypium mustelinum]) HSP 1 Score: 188 bits (477), Expect = 1.67e-59 Identity = 91/94 (96.81%), Postives = 91/94 (96.81%), Query Frame = 0
BLAST of MC06g1083 vs. NCBI nr
Match: TYJ18633.1 (hypothetical protein E1A91_A09G136600v1, partial [Gossypium mustelinum]) HSP 1 Score: 188 bits (477), Expect = 3.74e-59 Identity = 91/94 (96.81%), Postives = 91/94 (96.81%), Query Frame = 0
BLAST of MC06g1083 vs. NCBI nr
Match: KAG8483430.1 (hypothetical protein CXB51_023144 [Gossypium anomalum]) HSP 1 Score: 188 bits (477), Expect = 1.14e-58 Identity = 91/94 (96.81%), Postives = 91/94 (96.81%), Query Frame = 0
BLAST of MC06g1083 vs. NCBI nr
Match: KAB2086787.1 (hypothetical protein ES319_A04G058600v1, partial [Gossypium barbadense]) HSP 1 Score: 186 bits (471), Expect = 1.17e-58 Identity = 90/94 (95.74%), Postives = 90/94 (95.74%), Query Frame = 0
BLAST of MC06g1083 vs. ExPASy TrEMBL
Match: A0A5D2ZMK7 (Uncharacterized protein (Fragment) OS=Gossypium mustelinum OX=34275 GN=E1A91_A04G066200v1 PE=4 SV=1) HSP 1 Score: 188 bits (477), Expect = 6.25e-60 Identity = 91/94 (96.81%), Postives = 91/94 (96.81%), Query Frame = 0
BLAST of MC06g1083 vs. ExPASy TrEMBL
Match: A0A5D3AH37 (Uncharacterized protein (Fragment) OS=Gossypium mustelinum OX=34275 GN=E1A91_A01G117000v1 PE=4 SV=1) HSP 1 Score: 188 bits (477), Expect = 8.09e-60 Identity = 91/94 (96.81%), Postives = 91/94 (96.81%), Query Frame = 0
BLAST of MC06g1083 vs. ExPASy TrEMBL
Match: A0A5D2XXL3 (Uncharacterized protein (Fragment) OS=Gossypium mustelinum OX=34275 GN=E1A91_A09G136600v1 PE=4 SV=1) HSP 1 Score: 188 bits (477), Expect = 1.81e-59 Identity = 91/94 (96.81%), Postives = 91/94 (96.81%), Query Frame = 0
BLAST of MC06g1083 vs. ExPASy TrEMBL
Match: A0A5J5W6A2 (Uncharacterized protein (Fragment) OS=Gossypium barbadense OX=3634 GN=ES319_A04G058600v1 PE=4 SV=1) HSP 1 Score: 186 bits (471), Expect = 5.66e-59 Identity = 90/94 (95.74%), Postives = 90/94 (95.74%), Query Frame = 0
BLAST of MC06g1083 vs. ExPASy TrEMBL
Match: J9Y4H7 (Hypothetical chloroplast RF2 (Fragment) OS=Fragaria pentaphylla OX=101014 GN=ycf2 PE=4 SV=1) HSP 1 Score: 184 bits (468), Expect = 2.39e-58 Identity = 88/94 (93.62%), Postives = 91/94 (96.81%), Query Frame = 0
BLAST of MC06g1083 vs. TAIR 10
Match: ATCG00860.1 (Chloroplast Ycf2;ATPase, AAA type, core ) HSP 1 Score: 175.6 bits (444), Expect = 1.8e-44 Identity = 86/94 (91.49%), Postives = 89/94 (94.68%), Query Frame = 0
BLAST of MC06g1083 vs. TAIR 10
Match: ATCG01280.1 (Chloroplast Ycf2;ATPase, AAA type, core ) HSP 1 Score: 175.6 bits (444), Expect = 1.8e-44 Identity = 86/94 (91.49%), Postives = 89/94 (94.68%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|