
MC02g1022 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CCTGTTATAATAGGAAAGCCTTATATCTTGAAATTATTTCATCAAGTTGATGATAAAATACACGGACGTTCCAGTGGACATTATGCACTTGTTACACAACAACCCCTTAGAGGAAGGGCCAAGCAAGGTGGACAACGGGTGGGAGAAATGGAGGTTTGGGCTCTAGAGGGATTTGGTGTTGCTCATATTTTACAAGAGATGCTTACTTATAAATCTGATCATATTAGAGCTCGGCAAGAAGTACTT CCTGTTATAATAGGAAAGCCTTATATCTTGAAATTATTTCATCAAGTTGATGATAAAATACACGGACGTTCCAGTGGACATTATGCACTTGTTACACAACAACCCCTTAGAGGAAGGGCCAAGCAAGGTGGACAACGGGTGGGAGAAATGGAGGTTTGGGCTCTAGAGGGATTTGGTGTTGCTCATATTTTACAAGAGATGCTTACTTATAAATCTGATCATATTAGAGCTCGGCAAGAAGTACTT CCTGTTATAATAGGAAAGCCTTATATCTTGAAATTATTTCATCAAGTTGATGATAAAATACACGGACGTTCCAGTGGACATTATGCACTTGTTACACAACAACCCCTTAGAGGAAGGGCCAAGCAAGGTGGACAACGGGTGGGAGAAATGGAGGTTTGGGCTCTAGAGGGATTTGGTGTTGCTCATATTTTACAAGAGATGCTTACTTATAAATCTGATCATATTAGAGCTCGGCAAGAAGTACTT PVIIGKPYILKLFHQVDDKIHGRSSGHYALVTQQPLRGRAKQGGQRVGEMEVWALEGFGVAHILQEMLTYKSDHIRARQEVL Homology
BLAST of MC02g1022 vs. ExPASy Swiss-Prot
Match: Q8S8X9 (DNA-directed RNA polymerase subunit beta OS=Atropa belladonna OX=33113 GN=rpoB PE=3 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 4.7e-41 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of MC02g1022 vs. ExPASy Swiss-Prot
Match: Q4VZP1 (DNA-directed RNA polymerase subunit beta OS=Cucumis sativus OX=3659 GN=rpoB PE=3 SV=2) HSP 1 Score: 167.9 bits (424), Expect = 4.7e-41 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of MC02g1022 vs. ExPASy Swiss-Prot
Match: Q49L06 (DNA-directed RNA polymerase subunit beta OS=Eucalyptus globulus subsp. globulus OX=71271 GN=rpoB PE=3 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 4.7e-41 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of MC02g1022 vs. ExPASy Swiss-Prot
Match: Q3C1G7 (DNA-directed RNA polymerase subunit beta OS=Nicotiana sylvestris OX=4096 GN=rpoB PE=3 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 4.7e-41 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of MC02g1022 vs. ExPASy Swiss-Prot
Match: Q33C46 (DNA-directed RNA polymerase subunit beta OS=Nicotiana tomentosiformis OX=4098 GN=rpoB PE=3 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 4.7e-41 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of MC02g1022 vs. NCBI nr
Match: WP_199287517.1 (hypothetical protein, partial [Photobacterium chitinilyticum] >RWX52626.1 DNA-directed RNA polymerase subunit beta, partial [Photobacterium chitinilyticum]) HSP 1 Score: 167 bits (422), Expect = 5.06e-51 Identity = 80/82 (97.56%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of MC02g1022 vs. NCBI nr
Match: OMP13067.1 (hypothetical protein COLO4_02335, partial [Corchorus olitorius]) HSP 1 Score: 167 bits (422), Expect = 1.17e-50 Identity = 80/82 (97.56%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of MC02g1022 vs. NCBI nr
Match: AUT83538.1 (RpoB [Galium odoratum]) HSP 1 Score: 166 bits (419), Expect = 2.46e-50 Identity = 79/82 (96.34%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of MC02g1022 vs. NCBI nr
Match: TLX69649.1 (DNA-directed RNA polymerase subunit beta, partial [Labilibacter sediminis]) HSP 1 Score: 166 bits (419), Expect = 2.87e-50 Identity = 80/82 (97.56%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of MC02g1022 vs. NCBI nr
Match: AFS35502.1 (RNA polymerase beta subunit, partial [Fragaria pentaphylla]) HSP 1 Score: 168 bits (425), Expect = 2.95e-50 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of MC02g1022 vs. ExPASy TrEMBL
Match: A0A444JHR1 (DNA-directed RNA polymerase (Fragment) OS=Photobacterium chitinilyticum OX=2485123 GN=EDI28_26660 PE=4 SV=1) HSP 1 Score: 167 bits (422), Expect = 2.45e-51 Identity = 80/82 (97.56%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of MC02g1022 vs. ExPASy TrEMBL
Match: A0A1R3L182 (DNA-directed RNA polymerase (Fragment) OS=Corchorus olitorius OX=93759 GN=COLO4_02335 PE=3 SV=1) HSP 1 Score: 167 bits (422), Expect = 5.68e-51 Identity = 80/82 (97.56%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of MC02g1022 vs. ExPASy TrEMBL
Match: A0A2K9RN51 (DNA-directed RNA polymerase OS=Galium odoratum OX=35899 PE=3 SV=1) HSP 1 Score: 166 bits (419), Expect = 1.19e-50 Identity = 79/82 (96.34%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of MC02g1022 vs. ExPASy TrEMBL
Match: A0A5R9QKW6 (DNA-directed RNA polymerase (Fragment) OS=Labilibacter sediminis OX=2570926 GN=E9993_22820 PE=4 SV=1) HSP 1 Score: 166 bits (419), Expect = 1.39e-50 Identity = 80/82 (97.56%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of MC02g1022 vs. ExPASy TrEMBL
Match: J9Y2U6 (DNA-directed RNA polymerase (Fragment) OS=Fragaria pentaphylla OX=101014 GN=rpoB PE=3 SV=1) HSP 1 Score: 168 bits (425), Expect = 1.43e-50 Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of MC02g1022 vs. TAIR 10
Match: ATCG00190.1 (RNA polymerase subunit beta ) HSP 1 Score: 166.8 bits (421), Expect = 7.4e-42 Identity = 80/82 (97.56%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of MC02g1022 vs. TAIR 10
Match: AT4G21710.1 (DNA-directed RNA polymerase family protein ) HSP 1 Score: 67.8 bits (164), Expect = 4.7e-12 Identity = 33/75 (44.00%), Postives = 44/75 (58.67%), Query Frame = 0
BLAST of MC02g1022 vs. TAIR 10
Match: AT5G45140.1 (nuclear RNA polymerase C2 ) HSP 1 Score: 63.2 bits (152), Expect = 1.2e-10 Identity = 31/72 (43.06%), Postives = 43/72 (59.72%), Query Frame = 0
BLAST of MC02g1022 vs. TAIR 10
Match: AT1G29940.1 (nuclear RNA polymerase A2 ) HSP 1 Score: 58.9 bits (141), Expect = 2.2e-09 Identity = 29/73 (39.73%), Postives = 42/73 (57.53%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|