
MC02g0767 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGGGCGTTTGGGTGTTCGACAAGAACGGCGTGGCCCGGTTGATCGCGAACCCAACGCGGGAGTCGTTCGAGGGGAAGGACCCGCCGTATCCGGGGACGGCGACGGCGCCAGGGGCTCGGCCGAGAGTGCTGGTGTACCTTCCGGCGAACCAGGTGATCGGGTCGTACGCGGAACTGGAGCAGCGACTGGGTGAACTCGGGTGGACTCGGTACCGGAACTCATCCGCCGAACCGGAGGAACTCGTCCGATTCCATCGCTCCCACGACTCGGCCGACCTCATTTCCCTCCCCAAAAGCTTCGCCAAATTCAAGCCCATGCACATGTACGACATCGTCGTCAAAAATCGACATTTCTTCCAAGTTCGCGACCCAAAATCAGCAGCAGCCTCT ATGTCGGGCGTTTGGGTGTTCGACAAGAACGGCGTGGCCCGGTTGATCGCGAACCCAACGCGGGAGTCGTTCGAGGGGAAGGACCCGCCGTATCCGGGGACGGCGACGGCGCCAGGGGCTCGGCCGAGAGTGCTGGTGTACCTTCCGGCGAACCAGGTGATCGGGTCGTACGCGGAACTGGAGCAGCGACTGGGTGAACTCGGGTGGACTCGGTACCGGAACTCATCCGCCGAACCGGAGGAACTCGTCCGATTCCATCGCTCCCACGACTCGGCCGACCTCATTTCCCTCCCCAAAAGCTTCGCCAAATTCAAGCCCATGCACATGTACGACATCGTCGTCAAAAATCGACATTTCTTCCAAGTTCGCGACCCAAAATCAGCAGCAGCCTCT ATGTCGGGCGTTTGGGTGTTCGACAAGAACGGCGTGGCCCGGTTGATCGCGAACCCAACGCGGGAGTCGTTCGAGGGGAAGGACCCGCCGTATCCGGGGACGGCGACGGCGCCAGGGGCTCGGCCGAGAGTGCTGGTGTACCTTCCGGCGAACCAGGTGATCGGGTCGTACGCGGAACTGGAGCAGCGACTGGGTGAACTCGGGTGGACTCGGTACCGGAACTCATCCGCCGAACCGGAGGAACTCGTCCGATTCCATCGCTCCCACGACTCGGCCGACCTCATTTCCCTCCCCAAAAGCTTCGCCAAATTCAAGCCCATGCACATGTACGACATCGTCGTCAAAAATCGACATTTCTTCCAAGTTCGCGACCCAAAATCAGCAGCAGCCTCT MSGVWVFDKNGVARLIANPTRESFEGKDPPYPGTATAPGARPRVLVYLPANQVIGSYAELEQRLGELGWTRYRNSSAEPEELVRFHRSHDSADLISLPKSFAKFKPMHMYDIVVKNRHFFQVRDPKSAAAS Homology
BLAST of MC02g0767 vs. ExPASy Swiss-Prot
Match: Q5Q0B3 (Flowering-promoting factor 1-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FLP1 PE=2 SV=2) HSP 1 Score: 113.2 bits (282), Expect = 2.2e-24 Identity = 60/125 (48.00%), Postives = 81/125 (64.80%), Query Frame = 0
BLAST of MC02g0767 vs. ExPASy Swiss-Prot
Match: O24340 (Flowering-promoting factor 1 OS=Sinapis alba OX=3728 GN=FPF1 PE=2 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 2.0e-22 Identity = 62/124 (50.00%), Postives = 77/124 (62.10%), Query Frame = 0
BLAST of MC02g0767 vs. ExPASy Swiss-Prot
Match: Q9LXB5 (Flowering-promoting factor 1-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=FLP2 PE=2 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.7e-22 Identity = 58/124 (46.77%), Postives = 77/124 (62.10%), Query Frame = 0
BLAST of MC02g0767 vs. ExPASy Swiss-Prot
Match: O23624 (Flowering-promoting factor 1 OS=Arabidopsis thaliana OX=3702 GN=FPF1 PE=1 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.7e-22 Identity = 58/124 (46.77%), Postives = 77/124 (62.10%), Query Frame = 0
BLAST of MC02g0767 vs. ExPASy Swiss-Prot
Match: Q8LR63 (Flowering-promoting factor 1-like protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0933500 PE=2 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 4.6e-22 Identity = 57/128 (44.53%), Postives = 80/128 (62.50%), Query Frame = 0
BLAST of MC02g0767 vs. NCBI nr
Match: XP_022148408.1 (flowering-promoting factor 1-like [Momordica charantia]) HSP 1 Score: 269 bits (687), Expect = 7.25e-91 Identity = 131/131 (100.00%), Postives = 131/131 (100.00%), Query Frame = 0
BLAST of MC02g0767 vs. NCBI nr
Match: KAG6570697.1 (Flowering-promoting factor 1, partial [Cucurbita argyrosperma subsp. sororia] >KAG7010544.1 Flowering-promoting factor 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 232 bits (592), Expect = 2.03e-76 Identity = 116/131 (88.55%), Postives = 123/131 (93.89%), Query Frame = 0
BLAST of MC02g0767 vs. NCBI nr
Match: TXG74079.1 (hypothetical protein EZV62_002658 [Acer yangbiense]) HSP 1 Score: 204 bits (520), Expect = 1.86e-65 Identity = 100/130 (76.92%), Postives = 112/130 (86.15%), Query Frame = 0
BLAST of MC02g0767 vs. NCBI nr
Match: BBH04787.1 (flowering promoting factor 1 [Prunus dulcis] >VVA23053.1 PREDICTED: flowering-promoting factor [Prunus dulcis]) HSP 1 Score: 204 bits (519), Expect = 2.47e-65 Identity = 101/125 (80.80%), Postives = 109/125 (87.20%), Query Frame = 0
BLAST of MC02g0767 vs. NCBI nr
Match: CAB4282452.1 (unnamed protein product [Prunus armeniaca] >CAB4312865.1 unnamed protein product [Prunus armeniaca]) HSP 1 Score: 203 bits (516), Expect = 7.09e-65 Identity = 100/125 (80.00%), Postives = 109/125 (87.20%), Query Frame = 0
BLAST of MC02g0767 vs. ExPASy TrEMBL
Match: A0A6J1D405 (flowering-promoting factor 1-like OS=Momordica charantia OX=3673 GN=LOC111017063 PE=3 SV=1) HSP 1 Score: 269 bits (687), Expect = 3.51e-91 Identity = 131/131 (100.00%), Postives = 131/131 (100.00%), Query Frame = 0
BLAST of MC02g0767 vs. ExPASy TrEMBL
Match: A0A0A0KE84 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G190350 PE=3 SV=1) HSP 1 Score: 224 bits (571), Expect = 1.67e-73 Identity = 113/131 (86.26%), Postives = 119/131 (90.84%), Query Frame = 0
BLAST of MC02g0767 vs. ExPASy TrEMBL
Match: A0A5C7IY84 (Uncharacterized protein OS=Acer yangbiense OX=1000413 GN=EZV62_002658 PE=3 SV=1) HSP 1 Score: 204 bits (520), Expect = 9.00e-66 Identity = 100/130 (76.92%), Postives = 112/130 (86.15%), Query Frame = 0
BLAST of MC02g0767 vs. ExPASy TrEMBL
Match: A0A4Y1RLM7 (Flowering promoting factor 1 OS=Prunus dulcis OX=3755 GN=ALMOND_2B008132 PE=3 SV=1) HSP 1 Score: 204 bits (519), Expect = 1.20e-65 Identity = 101/125 (80.80%), Postives = 109/125 (87.20%), Query Frame = 0
BLAST of MC02g0767 vs. ExPASy TrEMBL
Match: M5WHZ4 (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_6G075900 PE=3 SV=1) HSP 1 Score: 203 bits (516), Expect = 3.43e-65 Identity = 100/125 (80.00%), Postives = 109/125 (87.20%), Query Frame = 0
BLAST of MC02g0767 vs. TAIR 10
Match: AT4G31380.1 (FPF1-like protein 1 ) HSP 1 Score: 113.2 bits (282), Expect = 1.6e-25 Identity = 60/125 (48.00%), Postives = 81/125 (64.80%), Query Frame = 0
BLAST of MC02g0767 vs. TAIR 10
Match: AT5G10625.1 (BEST Arabidopsis thaliana protein match is: flowering promoting factor 1 (TAIR:AT5G24860.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). ) HSP 1 Score: 106.3 bits (264), Expect = 1.9e-23 Identity = 58/124 (46.77%), Postives = 77/124 (62.10%), Query Frame = 0
BLAST of MC02g0767 vs. TAIR 10
Match: AT5G24860.1 (flowering promoting factor 1 ) HSP 1 Score: 106.3 bits (264), Expect = 1.9e-23 Identity = 58/124 (46.77%), Postives = 77/124 (62.10%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|