
Lsi08G008620 (gene) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGAAGAGGAATCCGGGGAGGCTATCCGGCCGGAGTTTCCGACGGGACGAGTGAAGAAGATAATGAAGCTCGACAAGGATATTGGCAAAGTGAATTCAGAAGCCTTGTTTCTAGTCTCATGCGCCACCGAGCTCTTCCTTAAGCTTCTCGCTGAAAAATCTGCCGAAGTCGCTGTCGAGAAGAAACGGAAGACCGTGAAACTTGAACACATCCGAATCGCCGCCAAAAGGCATCGATCGATCGGTGATTTTCTCCTTGATTCGCTTCCTCTTCCGTCTCAGCCGTCGGAGGCGCCGGCGAAGGACGAGAATCGCACTCGCACTGTCGTTGATAAAGTGGCTCCTGAAGGAACCCGTCGAATCGATGATTTCTTTCGCCGGCCAGCAAAGACAACGTCGGCGGAGACCAACGAGTCATAG ATGGAGGAAGAGGAATCCGGGGAGGCTATCCGGCCGGAGTTTCCGACGGGACGAGTGAAGAAGATAATGAAGCTCGACAAGGATATTGGCAAAGTGAATTCAGAAGCCTTGTTTCTAGTCTCATGCGCCACCGAGCTCTTCCTTAAGCTTCTCGCTGAAAAATCTGCCGAAGTCGCTGTCGAGAAGAAACGGAAGACCGTGAAACTTGAACACATCCGAATCGCCGCCAAAAGGCATCGATCGATCGGTGATTTTCTCCTTGATTCGCTTCCTCTTCCGTCTCAGCCGTCGGAGGCGCCGGCGAAGGACGAGAATCGCACTCGCACTGTCGTTGATAAAGTGGCTCCTGAAGGAACCCGTCGAATCGATGATTTCTTTCGCCGGCCAGCAAAGACAACGTCGGCGGAGACCAACGAGTCATAG ATGGAGGAAGAGGAATCCGGGGAGGCTATCCGGCCGGAGTTTCCGACGGGACGAGTGAAGAAGATAATGAAGCTCGACAAGGATATTGGCAAAGTGAATTCAGAAGCCTTGTTTCTAGTCTCATGCGCCACCGAGCTCTTCCTTAAGCTTCTCGCTGAAAAATCTGCCGAAGTCGCTGTCGAGAAGAAACGGAAGACCGTGAAACTTGAACACATCCGAATCGCCGCCAAAAGGCATCGATCGATCGGTGATTTTCTCCTTGATTCGCTTCCTCTTCCGTCTCAGCCGTCGGAGGCGCCGGCGAAGGACGAGAATCGCACTCGCACTGTCGTTGATAAAGTGGCTCCTGAAGGAACCCGTCGAATCGATGATTTCTTTCGCCGGCCAGCAAAGACAACGTCGGCGGAGACCAACGAGTCATAG MEEEESGEAIRPEFPTGRVKKIMKLDKDIGKVNSEALFLVSCATELFLKLLAEKSAEVAVEKKRKTVKLEHIRIAAKRHRSIGDFLLDSLPLPSQPSEAPAKDENRTRTVVDKVAPEGTRRIDDFFRRPAKTTSAETNES Homology
BLAST of Lsi08G008620 vs. ExPASy Swiss-Prot
Match: B0XTT5 (NCT transcriptional regulatory complex subunit A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=nctA PE=1 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.7e-06 Identity = 37/116 (31.90%), Postives = 60/116 (51.72%), Query Frame = 0
BLAST of Lsi08G008620 vs. ExPASy Swiss-Prot
Match: Q4X095 (NCT transcriptional regulatory complex subunit A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=nctA PE=1 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.7e-06 Identity = 37/116 (31.90%), Postives = 60/116 (51.72%), Query Frame = 0
BLAST of Lsi08G008620 vs. ExPASy Swiss-Prot
Match: Q2YDP3 (Dr1-associated corepressor OS=Bos taurus OX=9913 GN=DRAP1 PE=2 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 8.3e-06 Identity = 28/75 (37.33%), Postives = 45/75 (60.00%), Query Frame = 0
BLAST of Lsi08G008620 vs. ExPASy Swiss-Prot
Match: Q14919 (Dr1-associated corepressor OS=Homo sapiens OX=9606 GN=DRAP1 PE=1 SV=3) HSP 1 Score: 51.6 bits (122), Expect = 8.3e-06 Identity = 28/75 (37.33%), Postives = 45/75 (60.00%), Query Frame = 0
BLAST of Lsi08G008620 vs. ExPASy Swiss-Prot
Match: Q9D6N5 (Dr1-associated corepressor OS=Mus musculus OX=10090 GN=Drap1 PE=1 SV=3) HSP 1 Score: 51.6 bits (122), Expect = 8.3e-06 Identity = 28/75 (37.33%), Postives = 45/75 (60.00%), Query Frame = 0
BLAST of Lsi08G008620 vs. ExPASy TrEMBL
Match: A0A5A7VG98 (Dr1-associated corepressor OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold82G00350 PE=4 SV=1) HSP 1 Score: 250.0 bits (637), Expect = 5.9e-63 Identity = 130/140 (92.86%), Postives = 133/140 (95.00%), Query Frame = 0
BLAST of Lsi08G008620 vs. ExPASy TrEMBL
Match: A0A1S3BDL4 (dr1-associated corepressor OS=Cucumis melo OX=3656 GN=LOC103488501 PE=4 SV=1) HSP 1 Score: 247.7 bits (631), Expect = 2.9e-62 Identity = 130/140 (92.86%), Postives = 132/140 (94.29%), Query Frame = 0
BLAST of Lsi08G008620 vs. ExPASy TrEMBL
Match: A0A6J1HCT3 (DNA polymerase epsilon subunit C OS=Cucurbita moschata OX=3662 GN=LOC111462901 PE=4 SV=1) HSP 1 Score: 244.2 bits (622), Expect = 3.2e-61 Identity = 126/140 (90.00%), Postives = 132/140 (94.29%), Query Frame = 0
BLAST of Lsi08G008620 vs. ExPASy TrEMBL
Match: A0A6J1K737 (DNA polymerase epsilon subunit C OS=Cucurbita maxima OX=3661 GN=LOC111492238 PE=4 SV=1) HSP 1 Score: 243.0 bits (619), Expect = 7.2e-61 Identity = 126/140 (90.00%), Postives = 131/140 (93.57%), Query Frame = 0
BLAST of Lsi08G008620 vs. ExPASy TrEMBL
Match: A0A0A0KGV1 (CBFD_NFYB_HMF domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G365140 PE=4 SV=1) HSP 1 Score: 240.0 bits (611), Expect = 6.1e-60 Identity = 126/137 (91.97%), Postives = 128/137 (93.43%), Query Frame = 0
BLAST of Lsi08G008620 vs. NCBI nr
Match: KAA0064731.1 (dr1-associated corepressor [Cucumis melo var. makuwa]) HSP 1 Score: 250.0 bits (637), Expect = 1.2e-62 Identity = 130/140 (92.86%), Postives = 133/140 (95.00%), Query Frame = 0
BLAST of Lsi08G008620 vs. NCBI nr
Match: XP_038884228.1 (NCT transcriptional regulatory complex subunit A [Benincasa hispida]) HSP 1 Score: 248.1 bits (632), Expect = 4.6e-62 Identity = 130/140 (92.86%), Postives = 132/140 (94.29%), Query Frame = 0
BLAST of Lsi08G008620 vs. NCBI nr
Match: XP_008445504.1 (PREDICTED: dr1-associated corepressor [Cucumis melo]) HSP 1 Score: 247.7 bits (631), Expect = 6.1e-62 Identity = 130/140 (92.86%), Postives = 132/140 (94.29%), Query Frame = 0
BLAST of Lsi08G008620 vs. NCBI nr
Match: XP_022962477.1 (DNA polymerase epsilon subunit C [Cucurbita moschata]) HSP 1 Score: 244.2 bits (622), Expect = 6.7e-61 Identity = 126/140 (90.00%), Postives = 132/140 (94.29%), Query Frame = 0
BLAST of Lsi08G008620 vs. NCBI nr
Match: XP_022997291.1 (DNA polymerase epsilon subunit C [Cucurbita maxima]) HSP 1 Score: 243.0 bits (619), Expect = 1.5e-60 Identity = 126/140 (90.00%), Postives = 131/140 (93.57%), Query Frame = 0
BLAST of Lsi08G008620 vs. TAIR 10
Match: AT5G43250.1 (nuclear factor Y, subunit C13 ) HSP 1 Score: 149.4 bits (376), Expect = 2.1e-36 Identity = 88/139 (63.31%), Postives = 102/139 (73.38%), Query Frame = 0
BLAST of Lsi08G008620 vs. TAIR 10
Match: AT3G12480.1 (nuclear factor Y, subunit C11 ) HSP 1 Score: 55.1 bits (131), Expect = 5.4e-08 Identity = 29/73 (39.73%), Postives = 48/73 (65.75%), Query Frame = 0
BLAST of Lsi08G008620 vs. TAIR 10
Match: AT1G07980.1 (nuclear factor Y, subunit C10 ) HSP 1 Score: 52.8 bits (125), Expect = 2.7e-07 Identity = 28/91 (30.77%), Postives = 57/91 (62.64%), Query Frame = 0
BLAST of Lsi08G008620 vs. TAIR 10
Match: AT5G19490.1 (Histone superfamily protein ) HSP 1 Score: 52.0 bits (123), Expect = 4.5e-07 Identity = 34/105 (32.38%), Postives = 58/105 (55.24%), Query Frame = 0
BLAST of Lsi08G008620 vs. TAIR 10
Match: AT5G27910.1 (nuclear factor Y, subunit C8 ) HSP 1 Score: 47.8 bits (112), Expect = 8.6e-06 Identity = 39/106 (36.79%), Postives = 53/106 (50.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|