
IVF0009692 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTTCCGTTTGCCTCGAATTGTTACTGCTAAGCAAAGTCTTCAACGATCTTCATCAAAAGAAAATGGAACATCTCCGAAAATTGTTGATGTTCCTAAGGGCTATTTTAGTGTTTATGTCGGTGAGGAACATAAGAAGCGTTTTGTCATCCCACTATCTTACTTAAACCAGCCTTCTTTTCAAGATTTGTTGAGTCAAGCAGAAGAAGAATTTGGATATAATCATCCAATGGGTGGCATCACAATTCCTTGCCATGAAGACGAGTTCCTTGATCTCACTCGGAGTTTGAATGAATCATAA ATGGGTTTCCGTTTGCCTCGAATTGTTACTGCTAAGCAAAGTCTTCAACGATCTTCATCAAAAGAAAATGGAACATCTCCGAAAATTGTTGATGTTCCTAAGGGCTATTTTAGTGTTTATGTCGGTGAGGAACATAAGAAGCGTTTTGTCATCCCACTATCTTACTTAAACCAGCCTTCTTTTCAAGATTTGTTGAGTCAAGCAGAAGAAGAATTTGGATATAATCATCCAATGGGTGGCATCACAATTCCTTGCCATGAAGACGAGTTCCTTGATCTCACTCGGAGTTTGAATGAATCATAA ATGGGTTTCCGTTTGCCTCGAATTGTTACTGCTAAGCAAAGTCTTCAACGATCTTCATCAAAAGAAAATGGAACATCTCCGAAAATTGTTGATGTTCCTAAGGGCTATTTTAGTGTTTATGTCGGTGAGGAACATAAGAAGCGTTTTGTCATCCCACTATCTTACTTAAACCAGCCTTCTTTTCAAGATTTGTTGAGTCAAGCAGAAGAAGAATTTGGATATAATCATCCAATGGGTGGCATCACAATTCCTTGCCATGAAGACGAGTTCCTTGATCTCACTCGGAGTTTGAATGAATCATAA MGFRLPRIVTAKQSLQRSSSKENGTSPKIVDVPKGYFSVYVGEEHKKRFVIPLSYLNQPSFQDLLSQAEEEFGYNHPMGGITIPCHEDEFLDLTRSLNES Homology
BLAST of IVF0009692 vs. ExPASy Swiss-Prot
Match: P33080 (Auxin-induced protein X10A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 3.2e-28 Identity = 61/99 (61.62%), Postives = 76/99 (76.77%), Query Frame = 0
BLAST of IVF0009692 vs. ExPASy Swiss-Prot
Match: P33079 (Auxin-induced protein 10A5 OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 8.0e-27 Identity = 60/99 (60.61%), Postives = 76/99 (76.77%), Query Frame = 0
BLAST of IVF0009692 vs. ExPASy Swiss-Prot
Match: P32295 (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata OX=3916 GN=ARG7 PE=2 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 1.0e-26 Identity = 59/98 (60.20%), Postives = 73/98 (74.49%), Query Frame = 0
BLAST of IVF0009692 vs. ExPASy Swiss-Prot
Match: P33083 (Auxin-induced protein 6B OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 2.3e-26 Identity = 60/98 (61.22%), Postives = 72/98 (73.47%), Query Frame = 0
BLAST of IVF0009692 vs. ExPASy Swiss-Prot
Match: P33081 (Auxin-induced protein 15A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 2.0e-25 Identity = 61/98 (62.24%), Postives = 67/98 (68.37%), Query Frame = 0
BLAST of IVF0009692 vs. ExPASy TrEMBL
Match: A0A5A7U381 (Auxin-induced protein 15A-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold106G001140 PE=3 SV=1) HSP 1 Score: 208.8 bits (530), Expect = 1.1e-50 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of IVF0009692 vs. ExPASy TrEMBL
Match: A0A0A0K5T8 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G009020 PE=3 SV=1) HSP 1 Score: 198.7 bits (504), Expect = 1.1e-47 Identity = 94/100 (94.00%), Postives = 97/100 (97.00%), Query Frame = 0
BLAST of IVF0009692 vs. ExPASy TrEMBL
Match: A0A0A0K4J0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G008980 PE=3 SV=1) HSP 1 Score: 185.7 bits (470), Expect = 9.8e-44 Identity = 89/100 (89.00%), Postives = 93/100 (93.00%), Query Frame = 0
BLAST of IVF0009692 vs. ExPASy TrEMBL
Match: A0A6J1GL91 (auxin-induced protein X10A-like OS=Cucurbita moschata OX=3662 GN=LOC111454985 PE=3 SV=1) HSP 1 Score: 184.5 bits (467), Expect = 2.2e-43 Identity = 88/100 (88.00%), Postives = 92/100 (92.00%), Query Frame = 0
BLAST of IVF0009692 vs. ExPASy TrEMBL
Match: A0A6J1GJW5 (auxin-induced protein 15A-like OS=Cucurbita moschata OX=3662 GN=LOC111454987 PE=3 SV=1) HSP 1 Score: 183.7 bits (465), Expect = 3.7e-43 Identity = 88/100 (88.00%), Postives = 91/100 (91.00%), Query Frame = 0
BLAST of IVF0009692 vs. NCBI nr
Match: KAA0049698.1 (auxin-induced protein 15A-like [Cucumis melo var. makuwa] >TYK12174.1 auxin-induced protein 15A-like [Cucumis melo var. makuwa]) HSP 1 Score: 207 bits (526), Expect = 2.58e-67 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of IVF0009692 vs. NCBI nr
Match: KAE8645658.1 (hypothetical protein Csa_020170 [Cucumis sativus]) HSP 1 Score: 197 bits (500), Expect = 3.61e-63 Identity = 94/100 (94.00%), Postives = 97/100 (97.00%), Query Frame = 0
BLAST of IVF0009692 vs. NCBI nr
Match: XP_038887900.1 (auxin-induced protein X10A-like [Benincasa hispida]) HSP 1 Score: 189 bits (481), Expect = 6.60e-60 Identity = 92/100 (92.00%), Postives = 94/100 (94.00%), Query Frame = 0
BLAST of IVF0009692 vs. NCBI nr
Match: XP_011658575.1 (auxin-induced protein 15A [Cucumis sativus] >XP_011658577.2 auxin-induced protein 15A [Cucumis sativus]) HSP 1 Score: 184 bits (466), Expect = 3.68e-58 Identity = 89/100 (89.00%), Postives = 93/100 (93.00%), Query Frame = 0
BLAST of IVF0009692 vs. NCBI nr
Match: XP_022952255.1 (auxin-induced protein X10A-like [Cucurbita moschata] >KAG6572085.1 hypothetical protein SDJN03_28813, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 182 bits (463), Expect = 1.05e-57 Identity = 88/100 (88.00%), Postives = 92/100 (92.00%), Query Frame = 0
BLAST of IVF0009692 vs. TAIR 10
Match: AT4G38840.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 124.4 bits (311), Expect = 5.1e-29 Identity = 55/99 (55.56%), Postives = 78/99 (78.79%), Query Frame = 0
BLAST of IVF0009692 vs. TAIR 10
Match: AT4G34800.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 109.8 bits (273), Expect = 1.3e-24 Identity = 54/98 (55.10%), Postives = 69/98 (70.41%), Query Frame = 0
BLAST of IVF0009692 vs. TAIR 10
Match: AT5G18050.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 109.8 bits (273), Expect = 1.3e-24 Identity = 49/90 (54.44%), Postives = 69/90 (76.67%), Query Frame = 0
BLAST of IVF0009692 vs. TAIR 10
Match: AT5G18060.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 107.8 bits (268), Expect = 5.0e-24 Identity = 49/91 (53.85%), Postives = 69/91 (75.82%), Query Frame = 0
BLAST of IVF0009692 vs. TAIR 10
Match: AT4G34770.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 107.1 bits (266), Expect = 8.5e-24 Identity = 59/108 (54.63%), Postives = 73/108 (67.59%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|