HG10019330 (gene) Bottle gourd (Hangzhou Gourd) v1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAGAGGAGGCTTGTGCAGGGGACCCGGTTGAGCGGCGAGTGCGCTGCAGCGGGGGACGAAGTTGAGGAATTGAGCGCAGCGGCGAGCCATGCTCGTGACAAGAAGAAGGAGTCAGACCCATTGGAGAACTATTGCAAGGACAACCCAGAGACTGAGGAATGTCGCACCTATGACAATTGAATGCAGAGGAGGCTTGTGCAGGGGACCCGGTTGAGCGGCGAGTGCGCTGCAGCGGGGGACGAAGTTGAGGAATTGAGCGCAGCGGCGAGCCATGCTCGTGACAAGAAGAAGGAGTCAGACCCATTGGAGAACTATTGCAAGGACAACCCAGAGACTGAGGAATGTCGCACCTATGACAATTGA ATGCAGAGGAGGCTTGTGCAGGGGACCCGGTTGAGCGGCGAGTGCGCTGCAGCGGGGGACGAAGTTGAGGAATTGAGCGCAGCGGCGAGCCATGCTCGTGACAAGAAGAAGGAGTCAGACCCATTGGAGAACTATTGCAAGGACAACCCAGAGACTGAGGAATGTCGCACCTATGACAATTGA MQRRLVQGTRLSGECAAAGDEVEELSAAASHARDKKKESDPLENYCKDNPETEECRTYDN Homology
BLAST of HG10019330 vs. NCBI nr
Match: XP_022155326.1 (calvin cycle protein CP12-2, chloroplastic-like [Momordica charantia]) HSP 1 Score: 97.8 bits (242), Expect = 3.3e-17 Identity = 49/53 (92.45%), Postives = 50/53 (94.34%), Query Frame = 0
BLAST of HG10019330 vs. NCBI nr
Match: XP_038903303.1 (calvin cycle protein CP12-1, chloroplastic-like [Benincasa hispida]) HSP 1 Score: 96.7 bits (239), Expect = 7.4e-17 Identity = 48/53 (90.57%), Postives = 50/53 (94.34%), Query Frame = 0
BLAST of HG10019330 vs. NCBI nr
Match: XP_008454293.1 (PREDICTED: calvin cycle protein CP12-2, chloroplastic [Cucumis melo] >KAA0044414.1 calvin cycle protein CP12-2 [Cucumis melo var. makuwa] >TYK29541.1 calvin cycle protein CP12-2 [Cucumis melo var. makuwa]) HSP 1 Score: 96.7 bits (239), Expect = 7.4e-17 Identity = 48/53 (90.57%), Postives = 50/53 (94.34%), Query Frame = 0
BLAST of HG10019330 vs. NCBI nr
Match: XP_022934393.1 (calvin cycle protein CP12-2, chloroplastic-like [Cucurbita moschata] >XP_022984077.1 calvin cycle protein CP12-2, chloroplastic-like [Cucurbita maxima] >KAG6581299.1 Calvin cycle protein CP12-2, chloroplastic, partial [Cucurbita argyrosperma subsp. sororia] >KAG7018019.1 Calvin cycle protein CP12-2, chloroplastic, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 95.5 bits (236), Expect = 1.6e-16 Identity = 48/53 (90.57%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of HG10019330 vs. NCBI nr
Match: XP_004152225.1 (calvin cycle protein CP12-2, chloroplastic [Cucumis sativus] >KGN52853.1 hypothetical protein Csa_014965 [Cucumis sativus]) HSP 1 Score: 94.7 bits (234), Expect = 2.8e-16 Identity = 47/53 (88.68%), Postives = 50/53 (94.34%), Query Frame = 0
BLAST of HG10019330 vs. ExPASy Swiss-Prot
Match: Q9LZP9 (Calvin cycle protein CP12-2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP12-2 PE=1 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 3.8e-16 Identity = 45/55 (81.82%), Postives = 46/55 (83.64%), Query Frame = 0
BLAST of HG10019330 vs. ExPASy Swiss-Prot
Match: O22914 (Calvin cycle protein CP12-1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP12-1 PE=1 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 1.9e-15 Identity = 43/52 (82.69%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of HG10019330 vs. ExPASy Swiss-Prot
Match: A6Q0K5 (Calvin cycle protein CP12, chloroplastic OS=Chlamydomonas reinhardtii OX=3055 GN=CP12 PE=1 SV=2) HSP 1 Score: 52.8 bits (125), Expect = 1.6e-06 Identity = 28/53 (52.83%), Postives = 36/53 (67.92%), Query Frame = 0
BLAST of HG10019330 vs. ExPASy Swiss-Prot
Match: Q9C9K2 (Calvin cycle protein CP12-3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP12-3 PE=1 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 4.7e-06 Identity = 27/56 (48.21%), Postives = 38/56 (67.86%), Query Frame = 0
BLAST of HG10019330 vs. ExPASy TrEMBL
Match: A0A6J1DRE1 (calvin cycle protein CP12-2, chloroplastic-like OS=Momordica charantia OX=3673 GN=LOC111022459 PE=4 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 1.6e-17 Identity = 49/53 (92.45%), Postives = 50/53 (94.34%), Query Frame = 0
BLAST of HG10019330 vs. ExPASy TrEMBL
Match: A0A5D3E1R4 (Calvin cycle protein CP12-2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold655G001450 PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 3.6e-17 Identity = 48/53 (90.57%), Postives = 50/53 (94.34%), Query Frame = 0
BLAST of HG10019330 vs. ExPASy TrEMBL
Match: A0A1S3BZH5 (calvin cycle protein CP12-2, chloroplastic OS=Cucumis melo OX=3656 GN=LOC103494733 PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 3.6e-17 Identity = 48/53 (90.57%), Postives = 50/53 (94.34%), Query Frame = 0
BLAST of HG10019330 vs. ExPASy TrEMBL
Match: A0A6J1J155 (calvin cycle protein CP12-2, chloroplastic-like OS=Cucurbita maxima OX=3661 GN=LOC111482497 PE=4 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 8.0e-17 Identity = 48/53 (90.57%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of HG10019330 vs. ExPASy TrEMBL
Match: A0A6J1F7J3 (calvin cycle protein CP12-2, chloroplastic-like OS=Cucurbita moschata OX=3662 GN=LOC111441581 PE=4 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 8.0e-17 Identity = 48/53 (90.57%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of HG10019330 vs. TAIR 10
Match: AT3G62410.1 (CP12 domain-containing protein 2 ) HSP 1 Score: 84.7 bits (208), Expect = 2.7e-17 Identity = 45/55 (81.82%), Postives = 46/55 (83.64%), Query Frame = 0
BLAST of HG10019330 vs. TAIR 10
Match: AT2G47400.1 (CP12 domain-containing protein 1 ) HSP 1 Score: 82.4 bits (202), Expect = 1.3e-16 Identity = 43/52 (82.69%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of HG10019330 vs. TAIR 10
Match: AT1G76560.1 (CP12 domain-containing protein 3 ) HSP 1 Score: 51.2 bits (121), Expect = 3.3e-07 Identity = 27/56 (48.21%), Postives = 38/56 (67.86%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|