HG10017905 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAATATTATTTTGATCCATTAGGAAAATCATCATGGCCAGAACTTGTGGGAATTGAAGCTGAAATTGCAAAGCTTGTCATACAGAAAGACAATCCTAGAGTGGAAATAATTGACATTATATTAGCCGGTAGTCCAGTGCCTCGTGACTTTAGACAGGATCGAGTTCGAATTTTTGTGAACATACGAAATGTTGCAGTTGAGATACCAATCATTGGTTAA ATGAAATATTATTTTGATCCATTAGGAAAATCATCATGGCCAGAACTTGTGGGAATTGAAGCTGAAATTGCAAAGCTTGTCATACAGAAAGACAATCCTAGAGTGGAAATAATTGACATTATATTAGCCGGTAGTCCAGTGCCTCGTGACTTTAGACAGGATCGAGTTCGAATTTTTGTGAACATACGAAATGTTGCAGTTGAGATACCAATCATTGGTTAA ATGAAATATTATTTTGATCCATTAGGAAAATCATCATGGCCAGAACTTGTGGGAATTGAAGCTGAAATTGCAAAGCTTGTCATACAGAAAGACAATCCTAGAGTGGAAATAATTGACATTATATTAGCCGGTAGTCCAGTGCCTCGTGACTTTAGACAGGATCGAGTTCGAATTTTTGTGAACATACGAAATGTTGCAGTTGAGATACCAATCATTGGTTAA MKYYFDPLGKSSWPELVGIEAEIAKLVIQKDNPRVEIIDIILAGSPVPRDFRQDRVRIFVNIRNVAVEIPIIG Homology
BLAST of HG10017905 vs. NCBI nr
Match: KAG6571499.1 (Proteinase inhibitor I-B, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 87.0 bits (214), Expect = 7.1e-14 Identity = 42/69 (60.87%), Postives = 50/69 (72.46%), Query Frame = 0
BLAST of HG10017905 vs. NCBI nr
Match: KAG6571494.1 (hypothetical protein SDJN03_28222, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 85.1 bits (209), Expect = 2.7e-13 Identity = 41/69 (59.42%), Postives = 52/69 (75.36%), Query Frame = 0
BLAST of HG10017905 vs. NCBI nr
Match: XP_004247658.1 (wound-induced proteinase inhibitor 1 [Solanum lycopersicum]) HSP 1 Score: 83.2 bits (204), Expect = 1.0e-12 Identity = 40/65 (61.54%), Postives = 49/65 (75.38%), Query Frame = 0
BLAST of HG10017905 vs. NCBI nr
Match: TMW88525.1 (hypothetical protein EJD97_018437 [Solanum chilense]) HSP 1 Score: 80.9 bits (198), Expect = 5.1e-12 Identity = 38/65 (58.46%), Postives = 49/65 (75.38%), Query Frame = 0
BLAST of HG10017905 vs. NCBI nr
Match: KGN50840.1 (hypothetical protein Csa_004718 [Cucumis sativus]) HSP 1 Score: 80.5 bits (197), Expect = 6.7e-12 Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = 0
BLAST of HG10017905 vs. ExPASy Swiss-Prot
Match: P16231 (Wound-induced proteinase inhibitor 1 OS=Solanum peruvianum OX=4082 PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 3.7e-13 Identity = 35/62 (56.45%), Postives = 45/62 (72.58%), Query Frame = 0
BLAST of HG10017905 vs. ExPASy Swiss-Prot
Match: Q02214 (Trypsin inhibitor 1 OS=Nicotiana sylvestris OX=4096 PE=2 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.4e-12 Identity = 30/64 (46.88%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of HG10017905 vs. ExPASy Swiss-Prot
Match: Q00783 (Proteinase inhibitor 1 OS=Solanum tuberosum OX=4113 PE=3 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 4.1e-12 Identity = 32/69 (46.38%), Postives = 46/69 (66.67%), Query Frame = 0
BLAST of HG10017905 vs. ExPASy Swiss-Prot
Match: P05118 (Wound-induced proteinase inhibitor 1 OS=Solanum lycopersicum OX=4081 GN=PIIF PE=2 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 6.9e-12 Identity = 29/64 (45.31%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of HG10017905 vs. ExPASy Swiss-Prot
Match: P19873 (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 2.6e-11 Identity = 33/65 (50.77%), Postives = 46/65 (70.77%), Query Frame = 0
BLAST of HG10017905 vs. ExPASy TrEMBL
Match: A0A6N2B0Y4 (Uncharacterized protein OS=Solanum chilense OX=4083 GN=EJD97_018437 PE=3 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 2.5e-12 Identity = 38/65 (58.46%), Postives = 49/65 (75.38%), Query Frame = 0
BLAST of HG10017905 vs. ExPASy TrEMBL
Match: A0A0A0KME7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G286040 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 3.2e-12 Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = 0
BLAST of HG10017905 vs. ExPASy TrEMBL
Match: A0A6N2AU12 (Uncharacterized protein OS=Solanum chilense OX=4083 GN=EJD97_023458 PE=3 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 2.1e-11 Identity = 36/62 (58.06%), Postives = 46/62 (74.19%), Query Frame = 0
BLAST of HG10017905 vs. ExPASy TrEMBL
Match: Q40444 (Tumor-related protein (Fragment) OS=Nicotiana glauca x Nicotiana langsdorffii OX=79230 PE=2 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 3.6e-11 Identity = 32/64 (50.00%), Postives = 50/64 (78.12%), Query Frame = 0
BLAST of HG10017905 vs. ExPASy TrEMBL
Match: A0A3Q7I868 (Uncharacterized protein OS=Solanum lycopersicum OX=4081 GN=101247557 PE=3 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 3.6e-11 Identity = 35/62 (56.45%), Postives = 46/62 (74.19%), Query Frame = 0
BLAST of HG10017905 vs. TAIR 10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 65.5 bits (158), Expect = 2.1e-11 Identity = 35/68 (51.47%), Postives = 49/68 (72.06%), Query Frame = 0
BLAST of HG10017905 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 63.2 bits (152), Expect = 1.0e-10 Identity = 31/64 (48.44%), Postives = 42/64 (65.62%), Query Frame = 0
BLAST of HG10017905 vs. TAIR 10
Match: AT2G38900.2 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 46.2 bits (108), Expect = 1.3e-05 Identity = 24/75 (32.00%), Postives = 42/75 (56.00%), Query Frame = 0
BLAST of HG10017905 vs. TAIR 10
Match: AT2G38900.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 44.3 bits (103), Expect = 4.9e-05 Identity = 22/66 (33.33%), Postives = 38/66 (57.58%), Query Frame = 0
BLAST of HG10017905 vs. TAIR 10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 42.4 bits (98), Expect = 1.9e-04 Identity = 21/64 (32.81%), Postives = 36/64 (56.25%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|