
Csor.00g163180 (gene) Silver-seed gourd (wild; sororia) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSsinglepolypeptidestart_codonstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTAAGGCTCTTTTCCTTGTGGCTTCTCTTCTCCTCTACGTCCTATCGCTATCGTCCCTCGTAGCGGCAACCCAACGTTTAGATTTGGTTGGTAGCTACAAACCAATAGAAAACATAGATGATCCAAAGATTCAGAGCTTAGGTGAGTTCGCAGTCAATGAACACAATAAACAGGCAAAGACTCAACTCAAGTTCCAAAAAGTGATTAGTGGAGAAATGCAAATTGTGGCCGGGACCAACTATAAACTTCAATTGACAGCTCTTGAGGGGACTAGTAGCGGAACCTATGGCACCCTTGTGTTCACTGACCTCAACAACAAGAACAACCTTATCAACTTCTATGACGTCTCCAAATAG ATGGCTAAGGCTCTTTTCCTTGTGGCTTCTCTTCTCCTCTACGTCCTATCGCTATCGTCCCTCGTAGCGGCAACCCAACGTTTAGATTTGGTTGGTAGCTACAAACCAATAGAAAACATAGATGATCCAAAGATTCAGAGCTTAGGTGAGTTCGCAGTCAATGAACACAATAAACAGGCAAAGACTCAACTCAAGTTCCAAAAAGTGATTAGTGGAGAAATGCAAATTGTGGCCGGGACCAACTATAAACTTCAATTGACAGCTCTTGAGGGGACTAGTAGCGGAACCTATGGCACCCTTGTGTTCACTGACCTCAACAACAAGAACAACCTTATCAACTTCTATGACGTCTCCAAATAG ATGGCTAAGGCTCTTTTCCTTGTGGCTTCTCTTCTCCTCTACGTCCTATCGCTATCGTCCCTCGTAGCGGCAACCCAACGTTTAGATTTGGTTGGTAGCTACAAACCAATAGAAAACATAGATGATCCAAAGATTCAGAGCTTAGGTGAGTTCGCAGTCAATGAACACAATAAACAGGCAAAGACTCAACTCAAGTTCCAAAAAGTGATTAGTGGAGAAATGCAAATTGTGGCCGGGACCAACTATAAACTTCAATTGACAGCTCTTGAGGGGACTAGTAGCGGAACCTATGGCACCCTTGTGTTCACTGACCTCAACAACAAGAACAACCTTATCAACTTCTATGACGTCTCCAAATAG MAKALFLVASLLLYVLSLSSLVAATQRLDLVGSYKPIENIDDPKIQSLGEFAVNEHNKQAKTQLKFQKVISGEMQIVAGTNYKLQLTALEGTSSGTYGTLVFTDLNNKNNLINFYDVSK Homology
BLAST of Csor.00g163180 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 80.9 bits (198), Expect = 1.1e-14 Identity = 39/92 (42.39%), Postives = 63/92 (68.48%), Query Frame = 0
BLAST of Csor.00g163180 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 2.4e-14 Identity = 38/92 (41.30%), Postives = 63/92 (68.48%), Query Frame = 0
BLAST of Csor.00g163180 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 73.6 bits (179), Expect = 1.7e-12 Identity = 40/91 (43.96%), Postives = 66/91 (72.53%), Query Frame = 0
BLAST of Csor.00g163180 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 7.3e-11 Identity = 39/98 (39.80%), Postives = 60/98 (61.22%), Query Frame = 0
BLAST of Csor.00g163180 vs. ExPASy Swiss-Prot
Match: Q84WT8 (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 65.1 bits (157), Expect = 6.2e-10 Identity = 33/81 (40.74%), Postives = 53/81 (65.43%), Query Frame = 0
BLAST of Csor.00g163180 vs. NCBI nr
Match: KAG6583729.1 (Cysteine proteinase inhibitor 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 221 bits (563), Expect = 2.36e-72 Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 0
BLAST of Csor.00g163180 vs. NCBI nr
Match: KAG6583730.1 (Cysteine proteinase inhibitor 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 219 bits (559), Expect = 9.63e-72 Identity = 118/119 (99.16%), Postives = 118/119 (99.16%), Query Frame = 0
BLAST of Csor.00g163180 vs. NCBI nr
Match: KAG6583732.1 (Cysteine proteinase inhibitor 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 218 bits (555), Expect = 3.92e-71 Identity = 117/119 (98.32%), Postives = 117/119 (98.32%), Query Frame = 0
BLAST of Csor.00g163180 vs. NCBI nr
Match: XP_022927105.1 (cysteine proteinase inhibitor 1-like [Cucurbita moschata]) HSP 1 Score: 216 bits (551), Expect = 1.60e-70 Identity = 116/119 (97.48%), Postives = 117/119 (98.32%), Query Frame = 0
BLAST of Csor.00g163180 vs. NCBI nr
Match: XP_023520245.1 (cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 209 bits (533), Expect = 8.89e-68 Identity = 112/119 (94.12%), Postives = 115/119 (96.64%), Query Frame = 0
BLAST of Csor.00g163180 vs. ExPASy TrEMBL
Match: A0A6J1EMY2 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111434041 PE=4 SV=1) HSP 1 Score: 216 bits (551), Expect = 7.74e-71 Identity = 116/119 (97.48%), Postives = 117/119 (98.32%), Query Frame = 0
BLAST of Csor.00g163180 vs. ExPASy TrEMBL
Match: A0A6J1IC30 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111471626 PE=4 SV=1) HSP 1 Score: 197 bits (500), Expect = 4.63e-63 Identity = 107/119 (89.92%), Postives = 111/119 (93.28%), Query Frame = 0
BLAST of Csor.00g163180 vs. ExPASy TrEMBL
Match: A0A6J1IGE9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111474507 PE=4 SV=1) HSP 1 Score: 196 bits (497), Expect = 1.33e-62 Identity = 105/117 (89.74%), Postives = 109/117 (93.16%), Query Frame = 0
BLAST of Csor.00g163180 vs. ExPASy TrEMBL
Match: A0A6J1IJX9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475533 PE=4 SV=1) HSP 1 Score: 194 bits (494), Expect = 3.81e-62 Identity = 105/118 (88.98%), Postives = 109/118 (92.37%), Query Frame = 0
BLAST of Csor.00g163180 vs. ExPASy TrEMBL
Match: A0A6J1IIS7 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111474432 PE=4 SV=1) HSP 1 Score: 191 bits (485), Expect = 8.97e-61 Identity = 101/117 (86.32%), Postives = 108/117 (92.31%), Query Frame = 0
BLAST of Csor.00g163180 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 73.6 bits (179), Expect = 1.2e-13 Identity = 40/91 (43.96%), Postives = 66/91 (72.53%), Query Frame = 0
BLAST of Csor.00g163180 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 65.1 bits (157), Expect = 4.4e-11 Identity = 33/81 (40.74%), Postives = 53/81 (65.43%), Query Frame = 0
BLAST of Csor.00g163180 vs. TAIR 10
Match: AT5G12140.1 (cystatin-1 ) HSP 1 Score: 50.4 bits (119), Expect = 1.1e-06 Identity = 25/77 (32.47%), Postives = 47/77 (61.04%), Query Frame = 0
BLAST of Csor.00g163180 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 50.1 bits (118), Expect = 1.5e-06 Identity = 34/105 (32.38%), Postives = 57/105 (54.29%), Query Frame = 0
BLAST of Csor.00g163180 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 47.8 bits (112), Expect = 7.3e-06 Identity = 33/99 (33.33%), Postives = 51/99 (51.52%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (sororia) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|