
Csor.00g163150 (gene) Silver-seed gourd (wild; sororia) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSsinglepolypeptidestart_codonstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTAAGGCTCTTTTCTTTGTGGCTTCTCTTCTCCTCTACGTCCTATCGCTATCGTCCCTCGTAGCGGCAACCCAACGTTTGGATTTGGCTGGTAGCTACAAACCAATAGAAAACATAGATGATCCAAAGATTCAGAGCTTAGGTGAGTTCGCAGTCAATGAACACAATAAACAGGCAAAGACTCAACTCAAGTTCCAAAAAGTGATTAGTGGAGAAATGCAAATTGTGGCCGGGACCAACTATAAACTTCAATTGACAGCTCTTGAGGGGACTAGTAGCGGAACCTATGGCACCCTTGTGTTCACTGACCTCAACAACAAGAACAACCTTATCAACTTCTATGACGTTTCCAAATAG ATGGCTAAGGCTCTTTTCTTTGTGGCTTCTCTTCTCCTCTACGTCCTATCGCTATCGTCCCTCGTAGCGGCAACCCAACGTTTGGATTTGGCTGGTAGCTACAAACCAATAGAAAACATAGATGATCCAAAGATTCAGAGCTTAGGTGAGTTCGCAGTCAATGAACACAATAAACAGGCAAAGACTCAACTCAAGTTCCAAAAAGTGATTAGTGGAGAAATGCAAATTGTGGCCGGGACCAACTATAAACTTCAATTGACAGCTCTTGAGGGGACTAGTAGCGGAACCTATGGCACCCTTGTGTTCACTGACCTCAACAACAAGAACAACCTTATCAACTTCTATGACGTTTCCAAATAG ATGGCTAAGGCTCTTTTCTTTGTGGCTTCTCTTCTCCTCTACGTCCTATCGCTATCGTCCCTCGTAGCGGCAACCCAACGTTTGGATTTGGCTGGTAGCTACAAACCAATAGAAAACATAGATGATCCAAAGATTCAGAGCTTAGGTGAGTTCGCAGTCAATGAACACAATAAACAGGCAAAGACTCAACTCAAGTTCCAAAAAGTGATTAGTGGAGAAATGCAAATTGTGGCCGGGACCAACTATAAACTTCAATTGACAGCTCTTGAGGGGACTAGTAGCGGAACCTATGGCACCCTTGTGTTCACTGACCTCAACAACAAGAACAACCTTATCAACTTCTATGACGTTTCCAAATAG MAKALFFVASLLLYVLSLSSLVAATQRLDLAGSYKPIENIDDPKIQSLGEFAVNEHNKQAKTQLKFQKVISGEMQIVAGTNYKLQLTALEGTSSGTYGTLVFTDLNNKNNLINFYDVSK Homology
BLAST of Csor.00g163150 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 82.8 bits (203), Expect = 2.9e-15 Identity = 40/92 (43.48%), Postives = 64/92 (69.57%), Query Frame = 0
BLAST of Csor.00g163150 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 6.4e-15 Identity = 39/92 (42.39%), Postives = 64/92 (69.57%), Query Frame = 0
BLAST of Csor.00g163150 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 73.6 bits (179), Expect = 1.7e-12 Identity = 38/91 (41.76%), Postives = 62/91 (68.13%), Query Frame = 0
BLAST of Csor.00g163150 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 5.6e-11 Identity = 39/98 (39.80%), Postives = 60/98 (61.22%), Query Frame = 0
BLAST of Csor.00g163150 vs. ExPASy Swiss-Prot
Match: Q84WT8 (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 63.2 bits (152), Expect = 2.4e-09 Identity = 34/91 (37.36%), Postives = 59/91 (64.84%), Query Frame = 0
BLAST of Csor.00g163150 vs. NCBI nr
Match: KAG6583732.1 (Cysteine proteinase inhibitor 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 223 bits (567), Expect = 5.80e-73 Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 0
BLAST of Csor.00g163150 vs. NCBI nr
Match: KAG6583730.1 (Cysteine proteinase inhibitor 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 220 bits (561), Expect = 4.77e-72 Identity = 118/119 (99.16%), Postives = 118/119 (99.16%), Query Frame = 0
BLAST of Csor.00g163150 vs. NCBI nr
Match: KAG6583729.1 (Cysteine proteinase inhibitor 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 219 bits (557), Expect = 1.94e-71 Identity = 117/119 (98.32%), Postives = 117/119 (98.32%), Query Frame = 0
BLAST of Csor.00g163150 vs. NCBI nr
Match: XP_022927105.1 (cysteine proteinase inhibitor 1-like [Cucurbita moschata]) HSP 1 Score: 217 bits (553), Expect = 7.92e-71 Identity = 116/119 (97.48%), Postives = 117/119 (98.32%), Query Frame = 0
BLAST of Csor.00g163150 vs. NCBI nr
Match: XP_023520245.1 (cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 210 bits (535), Expect = 4.40e-68 Identity = 112/119 (94.12%), Postives = 115/119 (96.64%), Query Frame = 0
BLAST of Csor.00g163150 vs. ExPASy TrEMBL
Match: A0A6J1EMY2 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111434041 PE=4 SV=1) HSP 1 Score: 217 bits (553), Expect = 3.83e-71 Identity = 116/119 (97.48%), Postives = 117/119 (98.32%), Query Frame = 0
BLAST of Csor.00g163150 vs. ExPASy TrEMBL
Match: A0A6J1IC30 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111471626 PE=4 SV=1) HSP 1 Score: 197 bits (502), Expect = 2.30e-63 Identity = 107/119 (89.92%), Postives = 111/119 (93.28%), Query Frame = 0
BLAST of Csor.00g163150 vs. ExPASy TrEMBL
Match: A0A6J1IGE9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111474507 PE=4 SV=1) HSP 1 Score: 197 bits (501), Expect = 3.26e-63 Identity = 105/117 (89.74%), Postives = 109/117 (93.16%), Query Frame = 0
BLAST of Csor.00g163150 vs. ExPASy TrEMBL
Match: A0A6J1IJX9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475533 PE=4 SV=1) HSP 1 Score: 196 bits (498), Expect = 9.35e-63 Identity = 105/118 (88.98%), Postives = 109/118 (92.37%), Query Frame = 0
BLAST of Csor.00g163150 vs. ExPASy TrEMBL
Match: A0A6J1IIS7 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111474432 PE=4 SV=1) HSP 1 Score: 196 bits (497), Expect = 1.33e-62 Identity = 103/117 (88.03%), Postives = 110/117 (94.02%), Query Frame = 0
BLAST of Csor.00g163150 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 73.6 bits (179), Expect = 1.2e-13 Identity = 38/91 (41.76%), Postives = 62/91 (68.13%), Query Frame = 0
BLAST of Csor.00g163150 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 63.2 bits (152), Expect = 1.7e-10 Identity = 34/91 (37.36%), Postives = 59/91 (64.84%), Query Frame = 0
BLAST of Csor.00g163150 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 49.7 bits (117), Expect = 1.9e-06 Identity = 34/107 (31.78%), Postives = 54/107 (50.47%), Query Frame = 0
BLAST of Csor.00g163150 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 49.3 bits (116), Expect = 2.5e-06 Identity = 33/99 (33.33%), Postives = 51/99 (51.52%), Query Frame = 0
BLAST of Csor.00g163150 vs. TAIR 10
Match: AT5G12140.1 (cystatin-1 ) HSP 1 Score: 48.9 bits (115), Expect = 3.3e-06 Identity = 24/77 (31.17%), Postives = 46/77 (59.74%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (sororia) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|