Cp4.1LG04g07740 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATCGAGCCGTTTTGCGCCAAGTATCGTGACTTACAATTCATTGATATCAGCTTTTGCACGGGACGGTTTGTTAGATGAAGCTATGGAGCTAAAAAGACAGATGGTGGAGAAGGGGATCGAGCCTGATGTTTTTACTTACACGACGTTGTTGTCTGGTTTTGAGAAGACGGGAAAGGACGATTGTGCGATGAGAGTATTTGATGAGATGAGTTGCAGGGTGCCAACTGAATATATGCGCATTCAATGTGTTGATTAA ATGGAATCGAGCCGTTTTGCGCCAAGTATCGTGACTTACAATTCATTGATATCAGCTTTTGCACGGGACGGTTTGTTAGATGAAGCTATGGAGCTAAAAAGACAGATGGTGGAGAAGGGGATCGAGCCTGATGTTTTTACTTACACGACGTTGTTGTCTGGTTTTGAGAAGACGGGAAAGGACGATTGTGCGATGAGAGTATTTGATGAGATGAGTTGCAGGGTGCCAACTGAATATATGCGCATTCAATGTGTTGATTAA ATGGAATCGAGCCGTTTTGCGCCAAGTATCGTGACTTACAATTCATTGATATCAGCTTTTGCACGGGACGGTTTGTTAGATGAAGCTATGGAGCTAAAAAGACAGATGGTGGAGAAGGGGATCGAGCCTGATGTTTTTACTTACACGACGTTGTTGTCTGGTTTTGAGAAGACGGGAAAGGACGATTGTGCGATGAGAGTATTTGATGAGATGAGTTGCAGGGTGCCAACTGAATATATGCGCATTCAATGTGTTGATTAA MESSRFAPSIVTYNSLISAFARDGLLDEAMELKRQMVEKGIEPDVFTYTTLLSGFEKTGKDDCAMRVFDEMSCRVPTEYMRIQCVD Homology
BLAST of Cp4.1LG04g07740 vs. ExPASy Swiss-Prot
Match: Q9LYZ9 (Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana OX=3702 GN=At5g02860 PE=2 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 3.5e-23 Identity = 51/66 (77.27%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. ExPASy Swiss-Prot
Match: Q9LFC5 (Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana OX=3702 GN=At5g01110 PE=2 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 6.9e-11 Identity = 33/64 (51.56%), Postives = 43/64 (67.19%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. ExPASy Swiss-Prot
Match: P0C7Q9 (Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g22960 PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 2.6e-10 Identity = 33/64 (51.56%), Postives = 39/64 (60.94%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. ExPASy Swiss-Prot
Match: Q9FLL3 (Pentatricopeptide repeat-containing protein At5g41170, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g41170 PE=2 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.4e-10 Identity = 33/66 (50.00%), Postives = 44/66 (66.67%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. ExPASy Swiss-Prot
Match: Q9LPX2 (Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g12775 PE=2 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 5.9e-10 Identity = 27/68 (39.71%), Postives = 45/68 (66.18%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. NCBI nr
Match: KAG7022489.1 (Pentatricopeptide repeat-containing protein, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 135 bits (341), Expect = 7.73e-37 Identity = 67/71 (94.37%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. NCBI nr
Match: KAG6588704.1 (Pentatricopeptide repeat-containing protein, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 135 bits (341), Expect = 2.47e-35 Identity = 67/71 (94.37%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. NCBI nr
Match: XP_038888056.1 (pentatricopeptide repeat-containing protein At5g02860 [Benincasa hispida]) HSP 1 Score: 128 bits (322), Expect = 3.42e-32 Identity = 64/71 (90.14%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. NCBI nr
Match: XP_004137089.1 (pentatricopeptide repeat-containing protein At5g02860 [Cucumis sativus] >KGN43935.2 hypothetical protein Csa_017163 [Cucumis sativus]) HSP 1 Score: 125 bits (315), Expect = 3.01e-31 Identity = 62/71 (87.32%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. NCBI nr
Match: KAA0031354.1 (pentatricopeptide repeat-containing protein [Cucumis melo var. makuwa] >TYK06806.1 pentatricopeptide repeat-containing protein [Cucumis melo var. makuwa]) HSP 1 Score: 125 bits (314), Expect = 4.12e-31 Identity = 62/71 (87.32%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. ExPASy TrEMBL
Match: A0A0A0K4H7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G071530 PE=4 SV=1) HSP 1 Score: 125 bits (315), Expect = 1.47e-31 Identity = 62/71 (87.32%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. ExPASy TrEMBL
Match: A0A5A7SJN5 (Pentatricopeptide repeat-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold13G001090 PE=4 SV=1) HSP 1 Score: 125 bits (314), Expect = 1.99e-31 Identity = 62/71 (87.32%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. ExPASy TrEMBL
Match: A0A1S3C150 (pentatricopeptide repeat-containing protein At5g02860 OS=Cucumis melo OX=3656 GN=LOC103495294 PE=4 SV=1) HSP 1 Score: 125 bits (314), Expect = 2.00e-31 Identity = 62/71 (87.32%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. ExPASy TrEMBL
Match: A0A6J1IBL6 (pentatricopeptide repeat-containing protein At5g02860 OS=Cucurbita maxima OX=3661 GN=LOC111471013 PE=4 SV=1) HSP 1 Score: 124 bits (311), Expect = 5.06e-31 Identity = 62/71 (87.32%), Postives = 66/71 (92.96%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. ExPASy TrEMBL
Match: A0A6J1GLL1 (pentatricopeptide repeat-containing protein At5g02860 OS=Cucurbita moschata OX=3662 GN=LOC111455390 PE=4 SV=1) HSP 1 Score: 124 bits (311), Expect = 5.06e-31 Identity = 62/71 (87.32%), Postives = 66/71 (92.96%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. TAIR 10
Match: AT5G02860.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 108.6 bits (270), Expect = 2.5e-24 Identity = 51/66 (77.27%), Postives = 59/66 (89.39%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. TAIR 10
Match: AT5G01110.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 67.8 bits (164), Expect = 4.9e-12 Identity = 33/64 (51.56%), Postives = 43/64 (67.19%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. TAIR 10
Match: AT1G22960.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 65.9 bits (159), Expect = 1.9e-11 Identity = 33/64 (51.56%), Postives = 39/64 (60.94%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. TAIR 10
Match: AT5G41170.1 (Pentatricopeptide repeat (PPR-like) superfamily protein ) HSP 1 Score: 65.5 bits (158), Expect = 2.4e-11 Identity = 33/66 (50.00%), Postives = 44/66 (66.67%), Query Frame = 0
BLAST of Cp4.1LG04g07740 vs. TAIR 10
Match: AT1G12775.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 64.7 bits (156), Expect = 4.2e-11 Identity = 27/68 (39.71%), Postives = 45/68 (66.18%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|