
Cmc11g0303121 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGCTCCTCGAACCATCCACTTTACTGCCGTACTTCGTATCCTTCGCTATGTCAAGGGAACCTTGGGACATGGACTTCAGTTTTCTTCTCAATCCTCTCTTGTATTATCTGGCTATTCCGATGCAGATTGGGTTGAGGATCCCACTGATCGACGTTCTACAACCGGTTACTGCTTCTACTTAAGCGATTCTCTCATTTCTTGGCGTAGTAAGAAACAAAGTGTTGTCTCTCGTTCTAGTACTGAATCAGAATATCGTGCTCTTGCTGATGCTACCGCCGAACTTTTATGGCTTCATTGGCTTCTTGCTGATATGGGTGTTCCCCAGCAAGGGTCCCACTCTCCTTCATTGTGA ATGGCTGCTCCTCGAACCATCCACTTTACTGCCGTACTTCGTATCCTTCGCTATGTCAAGGGAACCTTGGGACATGGACTTCAGTTTTCTTCTCAATCCTCTCTTGTATTATCTGGCTATTCCGATGCAGATTGGGTTGAGGATCCCACTGATCGACGTTCTACAACCGGTTACTGCTTCTACTTAAGCGATTCTCTCATTTCTTGGCGTAGTAAGAAACAAAGTGTTGTCTCTCGTTCTAGTACTGAATCAGAATATCGTGCTCTTGCTGATGCTACCGCCGAACTTTTATGGCTTCATTGGCTTCTTGCTGATATGGGTGTTCCCCAGCAAGGGTCCCACTCTCCTTCATTGTGA ATGGCTGCTCCTCGAACCATCCACTTTACTGCCGTACTTCGTATCCTTCGCTATGTCAAGGGAACCTTGGGACATGGACTTCAGTTTTCTTCTCAATCCTCTCTTGTATTATCTGGCTATTCCGATGCAGATTGGGTTGAGGATCCCACTGATCGACGTTCTACAACCGGTTACTGCTTCTACTTAAGCGATTCTCTCATTTCTTGGCGTAGTAAGAAACAAAGTGTTGTCTCTCGTTCTAGTACTGAATCAGAATATCGTGCTCTTGCTGATGCTACCGCCGAACTTTTATGGCTTCATTGGCTTCTTGCTGATATGGGTGTTCCCCAGCAAGGGTCCCACTCTCCTTCATTGTGA MAAPRTIHFTAVLRILRYVKGTLGHGLQFSSQSSLVLSGYSDADWVEDPTDRRSTTGYCFYLSDSLISWRSKKQSVVSRSSTESEYRALADATAELLWLHWLLADMGVPQQGSHSPSL Homology
BLAST of Cmc11g0303121 vs. NCBI nr
Match: TYK30390.1 (putative mitochondrial protein [Cucumis melo var. makuwa]) HSP 1 Score: 220.3 bits (560), Expect = 8.7e-54 Identity = 107/112 (95.54%), Postives = 108/112 (96.43%), Query Frame = 0
BLAST of Cmc11g0303121 vs. NCBI nr
Match: KAA0037745.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 219.2 bits (557), Expect = 1.9e-53 Identity = 108/112 (96.43%), Postives = 108/112 (96.43%), Query Frame = 0
BLAST of Cmc11g0303121 vs. NCBI nr
Match: KAA0041601.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa] >KAA0065379.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa] >TYK12000.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 219.2 bits (557), Expect = 1.9e-53 Identity = 108/112 (96.43%), Postives = 108/112 (96.43%), Query Frame = 0
BLAST of Cmc11g0303121 vs. NCBI nr
Match: KAA0054647.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 219.2 bits (557), Expect = 1.9e-53 Identity = 108/112 (96.43%), Postives = 108/112 (96.43%), Query Frame = 0
BLAST of Cmc11g0303121 vs. NCBI nr
Match: KAA0060225.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 219.2 bits (557), Expect = 1.9e-53 Identity = 108/112 (96.43%), Postives = 108/112 (96.43%), Query Frame = 0
BLAST of Cmc11g0303121 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 9.1e-22 Identity = 55/116 (47.41%), Postives = 72/116 (62.07%), Query Frame = 0
BLAST of Cmc11g0303121 vs. ExPASy Swiss-Prot
Match: P0CV72 (Secreted RxLR effector protein 161 OS=Plasmopara viticola OX=143451 GN=RXLR161 PE=2 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 4.5e-21 Identity = 49/96 (51.04%), Postives = 65/96 (67.71%), Query Frame = 0
BLAST of Cmc11g0303121 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 1.3e-20 Identity = 51/108 (47.22%), Postives = 67/108 (62.04%), Query Frame = 0
BLAST of Cmc11g0303121 vs. ExPASy Swiss-Prot
Match: P92519 (Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana OX=3702 GN=AtMg00810 PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.7e-20 Identity = 49/98 (50.00%), Postives = 63/98 (64.29%), Query Frame = 0
BLAST of Cmc11g0303121 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 2.0e-16 Identity = 47/108 (43.52%), Postives = 66/108 (61.11%), Query Frame = 0
BLAST of Cmc11g0303121 vs. ExPASy TrEMBL
Match: A0A5D3E4B0 (Putative mitochondrial protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold2254G00020 PE=4 SV=1) HSP 1 Score: 220.3 bits (560), Expect = 4.2e-54 Identity = 107/112 (95.54%), Postives = 108/112 (96.43%), Query Frame = 0
BLAST of Cmc11g0303121 vs. ExPASy TrEMBL
Match: A0A5A7VIT8 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1017G00050 PE=4 SV=1) HSP 1 Score: 219.2 bits (557), Expect = 9.4e-54 Identity = 108/112 (96.43%), Postives = 108/112 (96.43%), Query Frame = 0
BLAST of Cmc11g0303121 vs. ExPASy TrEMBL
Match: A0A5A7T8F2 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold141G00410 PE=4 SV=1) HSP 1 Score: 219.2 bits (557), Expect = 9.4e-54 Identity = 108/112 (96.43%), Postives = 108/112 (96.43%), Query Frame = 0
BLAST of Cmc11g0303121 vs. ExPASy TrEMBL
Match: A0A5A7UJ79 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold24G004570 PE=4 SV=1) HSP 1 Score: 219.2 bits (557), Expect = 9.4e-54 Identity = 108/112 (96.43%), Postives = 108/112 (96.43%), Query Frame = 0
BLAST of Cmc11g0303121 vs. ExPASy TrEMBL
Match: A0A5A7V2X4 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold386G00530 PE=4 SV=1) HSP 1 Score: 219.2 bits (557), Expect = 9.4e-54 Identity = 108/112 (96.43%), Postives = 108/112 (96.43%), Query Frame = 0
BLAST of Cmc11g0303121 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 115.2 bits (287), Expect = 3.7e-26 Identity = 56/107 (52.34%), Postives = 75/107 (70.09%), Query Frame = 0
BLAST of Cmc11g0303121 vs. TAIR 10
Match: ATMG00810.1 (DNA/RNA polymerases superfamily protein ) HSP 1 Score: 100.1 bits (248), Expect = 1.2e-21 Identity = 49/98 (50.00%), Postives = 63/98 (64.29%), Query Frame = 0
BLAST of Cmc11g0303121 vs. TAIR 10
Match: ATMG00240.1 (Gag-Pol-related retrotransposon family protein ) HSP 1 Score: 63.5 bits (153), Expect = 1.3e-10 Identity = 28/58 (48.28%), Postives = 38/58 (65.52%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
|