Cmc08g0225341 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AAGAAGAATGCAAGAATGGTTGTGGGGAATTTAGAATGGAGGCTGTGGGTTATAAGGAATCTGAGGCCATGAGTTTCAAGTAATTTCTTCCCTCTTTATTCTTAGAAGAAATGTATATATGTTGTGAAGGAATTTCTTACTCTGGGTTTTGCTTATTCTCAATATTTTCTTTCTCTTTAGGCCCTTACAACGTAAAGATGCTTGATTTTGAGGGTTTTGTTTATTCTCAATAGTTTATTGTTATTTACATTGTATTTTCACGTCATATATGTCTAATATGATGGAATACACTCAAATGGATATGCATATGATGTGAGTTTGATAGAAATTTCTGTATTTTGGGATTTTACTCGTTTCGTTTGTCTTATCTACTTTGTTAATTTGTGTTTTAGTTCATTTAATATTCTAGTTTATTGCTGCACACAACATGTTCGATAGAACTCCTCAGTTAGATTATTCTTCCAACGATGTATATGGTGAAACGAGATGGTCGTCAAGAAGCAGTGCATTTCGACAAGATCACTGCCCGTCTGAAGAAACTAAGTTATGGCCTCAACATCGATCAATGTGATCCAGTTTTGGTCTCCCAGAAAGTCTGTGTTGGAGTTTACAAGGGCATACCACTAGCCAGCTTGATGAATTGGCCGTTGAAATGGTTGCTACTATGA AAGAAGAATGCAAGAATGGTTGTGGGGAATTTAGAATGGAGGCTGTGGGTTATAAGGAATCTGAGGCCATGAGTTTCAATTTATTGCTGCACACAACATGTTCGATAGAACTCCTCAGTTAGATTATTCTTCCAACGATGTATATGGTGAAACGAGATGGTCGTCAAGAAGCAGTGCATTTCGACAAGATCACTGCCCGTCTGAAGAAACTAAGTTATGGCCTCAACATCGATCAATGTGATCCAGTTTTGGTCTCCCAGAAAGTCTGTGTTGGAGTTTACAAGGGCATACCACTAGCCAGCTTGATGAATTGGCCGTTGAAATGGTTGCTACTATGA ATGTATATGGTGAAACGAGATGGTCGTCAAGAAGCAGTGCATTTCGACAAGATCACTGCCCGTCTGAAGAAACTAAGTTATGGCCTCAACATCGATCAATGTGATCCAGTTTTGGTCTCCCAGAAAGTCTGTGTTGGAGTTTACAAGGGCATACCACTAGCCAGCTTGATGAATTGGCCGTTGAAATGGTTGCTACTATGA MYMVKRDGRQEAVHFDKITARLKKLSYGLNIDQCDPVLVSQKVCVGVYKGIPLASLMNWPLKWLLL Homology
BLAST of Cmc08g0225341 vs. NCBI nr
Match: TYK14136.1 (ribonucleoside-diphosphate reductase large subunit-like [Cucumis melo var. makuwa]) HSP 1 Score: 136.7 bits (343), Expect = 7.1e-29 Identity = 65/66 (98.48%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of Cmc08g0225341 vs. NCBI nr
Match: KAA0056131.1 (ribonucleoside-diphosphate reductase large subunit-like [Cucumis melo var. makuwa]) HSP 1 Score: 136.3 bits (342), Expect = 9.3e-29 Identity = 65/66 (98.48%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of Cmc08g0225341 vs. NCBI nr
Match: GFZ14655.1 (ribonucleotide reductase 1 [Actinidia rufa]) HSP 1 Score: 102.1 bits (253), Expect = 1.9e-18 Identity = 47/56 (83.93%), Postives = 51/56 (91.07%), Query Frame = 0
BLAST of Cmc08g0225341 vs. NCBI nr
Match: GFY91178.1 (ribonucleotide reductase 1 [Actinidia rufa]) HSP 1 Score: 102.1 bits (253), Expect = 1.9e-18 Identity = 47/56 (83.93%), Postives = 51/56 (91.07%), Query Frame = 0
BLAST of Cmc08g0225341 vs. NCBI nr
Match: XP_008440987.1 (PREDICTED: ribonucleoside-diphosphate reductase large subunit [Cucumis melo] >KAA0025571.1 ribonucleoside-diphosphate reductase large subunit [Cucumis melo var. makuwa]) HSP 1 Score: 102.1 bits (253), Expect = 1.9e-18 Identity = 47/56 (83.93%), Postives = 51/56 (91.07%), Query Frame = 0
BLAST of Cmc08g0225341 vs. ExPASy Swiss-Prot
Match: Q9SJ20 (Ribonucleoside-diphosphate reductase large subunit OS=Arabidopsis thaliana OX=3702 GN=RNR1 PE=1 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 8.2e-20 Identity = 44/56 (78.57%), Postives = 49/56 (87.50%), Query Frame = 0
BLAST of Cmc08g0225341 vs. ExPASy Swiss-Prot
Match: Q03604 (Ribonucleoside-diphosphate reductase large subunit OS=Caenorhabditis elegans OX=6239 GN=rnr-1 PE=3 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 6.7e-14 Identity = 36/57 (63.16%), Postives = 45/57 (78.95%), Query Frame = 0
BLAST of Cmc08g0225341 vs. ExPASy Swiss-Prot
Match: Q9UW15 (Ribonucleoside-diphosphate reductase large chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=rnr-1 PE=1 SV=2) HSP 1 Score: 72.0 bits (175), Expect = 2.8e-12 Identity = 33/56 (58.93%), Postives = 42/56 (75.00%), Query Frame = 0
BLAST of Cmc08g0225341 vs. ExPASy Swiss-Prot
Match: P48591 (Ribonucleoside-diphosphate reductase large subunit OS=Drosophila melanogaster OX=7227 GN=RnrL PE=1 SV=2) HSP 1 Score: 70.1 bits (170), Expect = 1.1e-11 Identity = 31/58 (53.45%), Postives = 43/58 (74.14%), Query Frame = 0
BLAST of Cmc08g0225341 vs. ExPASy Swiss-Prot
Match: P36602 (Ribonucleoside-diphosphate reductase large chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc22 PE=1 SV=2) HSP 1 Score: 69.7 bits (169), Expect = 1.4e-11 Identity = 33/58 (56.90%), Postives = 41/58 (70.69%), Query Frame = 0
BLAST of Cmc08g0225341 vs. ExPASy TrEMBL
Match: A0A5D3CUQ2 (Ribonucleoside-diphosphate reductase large subunit-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold513G00040 PE=4 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 3.4e-29 Identity = 65/66 (98.48%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of Cmc08g0225341 vs. ExPASy TrEMBL
Match: A0A5A7URH2 (Ribonucleoside-diphosphate reductase large subunit-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold697G00100 PE=4 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 4.5e-29 Identity = 65/66 (98.48%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of Cmc08g0225341 vs. ExPASy TrEMBL
Match: A0A5D3CLK7 (Ribonucleoside-diphosphate reductase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold255G00200 PE=3 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 9.4e-19 Identity = 47/56 (83.93%), Postives = 51/56 (91.07%), Query Frame = 0
BLAST of Cmc08g0225341 vs. ExPASy TrEMBL
Match: A0A5A7SMV6 (Ribonucleoside-diphosphate reductase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold253G00600 PE=3 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 9.4e-19 Identity = 47/56 (83.93%), Postives = 51/56 (91.07%), Query Frame = 0
BLAST of Cmc08g0225341 vs. ExPASy TrEMBL
Match: A0A7J0GUY0 (Ribonucleoside-diphosphate reductase OS=Actinidia rufa OX=165716 GN=Acr_24g0008450 PE=3 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 9.4e-19 Identity = 47/56 (83.93%), Postives = 51/56 (91.07%), Query Frame = 0
BLAST of Cmc08g0225341 vs. TAIR 10
Match: AT2G21790.1 (ribonucleotide reductase 1 ) HSP 1 Score: 97.1 bits (240), Expect = 5.8e-21 Identity = 44/56 (78.57%), Postives = 49/56 (87.50%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|