
Cmc06g0167391 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATTTGCATGGACCGATACATGATTTTCTTGTAGTCTTGTTGGGATCAGATCTTATATCAGGAAGTATGGGAGTACTATTATTTAACAACTCCATTTATTTTGCTTTTTCGTTAGGACTAGTTCTTGTTTCTATATCCTTATTCTATATTCTGGCAAACATCCAGTTTGTAGCTGTTATGCAACTCCTTATTTACGTGGGAGCTATAAATGTTTCAATCATATTTGTTATGATATCATGA ATGGATTTGCATGGACCGATACATGATTTTCTTGTAGTCTTGTTGGGATCAGATCTTATATCAGGAAGTATGGGAGTACTATTATTTAACAACTCCATTTATTTTGCTTTTTCGTTAGGACTAGTTCTTGTTTCTATATCCTTATTCTATATTCTGGCAAACATCCAGTTTGTAGCTGTTATGCAACTCCTTATTTACGTGGGAGCTATAAATGTTTCAATCATATTTGTTATGATATCATGA ATGGATTTGCATGGACCGATACATGATTTTCTTGTAGTCTTGTTGGGATCAGATCTTATATCAGGAAGTATGGGAGTACTATTATTTAACAACTCCATTTATTTTGCTTTTTCGTTAGGACTAGTTCTTGTTTCTATATCCTTATTCTATATTCTGGCAAACATCCAGTTTGTAGCTGTTATGCAACTCCTTATTTACGTGGGAGCTATAAATGTTTCAATCATATTTGTTATGATATCATGA MDLHGPIHDFLVVLLGSDLISGSMGVLLFNNSIYFAFSLGLVLVSISLFYILANIQFVAVMQLLIYVGAINVSIIFVMIS Homology
BLAST of Cmc06g0167391 vs. NCBI nr
Match: YP_009560888.1 (NdhG [Trichosanthes kirilowii] >YP_009752464.1 NADH dehydrogenase subunit G [Trichosanthes tricuspidata] >YP_009753757.1 NADH dehydrogenase subunit G [Trichosanthes nervifolia] >QAB33239.1 NdhG [Trichosanthes kirilowii] >QIT04860.1 NADH dehydrogenase subunit G [Trichosanthes tricuspidata] >QIT05368.1 NADH dehydrogenase subunit G [Trichosanthes nervifolia]) HSP 1 Score: 112.8 bits (281), Expect = 1.3e-21 Identity = 68/79 (86.08%), Postives = 70/79 (88.61%), Query Frame = 0
BLAST of Cmc06g0167391 vs. NCBI nr
Match: YP_009447504.1 (NADH dehydrogenase subunit 6 [Cucurbita maxima] >YP_009447589.1 NADH dehydrogenase subunit 6 [Cucurbita moschata] >YP_009505133.1 NADH dehydrogenase subunit 6 [Cucurbita pepo] >ALO21764.1 NdhG [Cucurbita argyrosperma] >ALO21805.1 NdhG [Cucurbita argyrosperma var. palmeri] >ALO21874.1 NdhG [Cucurbita argyrosperma subsp. sororia] >ALO22026.1 NdhG [Cucurbita ecuadorensis] >ALO22142.1 NdhG [Cucurbita ficifolia] >ALO22239.1 NdhG [Cucurbita lundelliana] >ALO22287.1 NdhG [Cucurbita maxima subsp. andreana] >ALO22418.1 NdhG [Cucurbita okeechobeensis] >ALO22489.1 NdhG [Cucurbita okeechobeensis subsp. martinezii] >ALO22598.1 NdhG [Cucurbita pepo subsp. fraterna] >ALO22623.1 NdhG [Cucurbita pepo subsp. ovifera] >ALO22729.1 NdhG [Cucurbita pepo var. ozarkana] >ALO22777.1 NdhG [Cucurbita pepo subsp. pepo] >ALO22836.1 NdhG [Cucurbita pepo var. texana]) HSP 1 Score: 112.8 bits (281), Expect = 1.3e-21 Identity = 68/79 (86.08%), Postives = 70/79 (88.61%), Query Frame = 0
BLAST of Cmc06g0167391 vs. NCBI nr
Match: YP_009317439.1 (NADH dehydrogenase subunit 6 [Coccinia grandis] >AOX48754.1 NADH dehydrogenase subunit 6 [Coccinia grandis] >AOX48839.1 NADH dehydrogenase subunit 6 [Coccinia grandis]) HSP 1 Score: 112.8 bits (281), Expect = 1.3e-21 Identity = 68/79 (86.08%), Postives = 70/79 (88.61%), Query Frame = 0
BLAST of Cmc06g0167391 vs. NCBI nr
Match: YP_009525238.1 (NADH-plastoquinone oxidoreductase subunit 6 [Hodgsonia macrocarpa] >YP_009751704.1 NADH dehydrogenase subunit G [Hodgsonia heteroclita] >YP_009752209.1 NADH dehydrogenase subunit G [Linnaeosicyos amara] >YP_009752216.1 NADH dehydrogenase subunit G [Linnaeosicyos amara] >YP_009752295.1 NADH dehydrogenase subunit G [Trichosanthes baviensis] >YP_009753840.1 NADH dehydrogenase subunit G [Trichosanthes pilosa] >AXR94524.1 NADH-plastoquinone oxidoreductase subunit 6 [Hodgsonia macrocarpa] >AXR94610.1 NADH-plastoquinone oxidoreductase subunit 6 [Hodgsonia macrocarpa] >AXR94694.1 NADH-plastoquinone oxidoreductase subunit 6 [Hodgsonia macrocarpa] >AXR94779.1 NADH-plastoquinone oxidoreductase subunit 6 [Hodgsonia macrocarpa] >QIT04269.1 NADH dehydrogenase subunit G [Trichosanthes baviensis]) HSP 1 Score: 112.8 bits (281), Expect = 1.3e-21 Identity = 68/79 (86.08%), Postives = 70/79 (88.61%), Query Frame = 0
BLAST of Cmc06g0167391 vs. NCBI nr
Match: YP_004841838.1 (NADH-plastoquinone oxidoreductase subunit 6 [Cucumis melo subsp. melo] >YP_009860128.1 NADH-plastoquinone oxidoreductase subunit 6 [Cucumis melo subsp. agrestis] >ASY96657.1 NADH dehydrogenase subunit 6 [Cucumis melo var. conomon] >ASY96744.1 NADH dehydrogenase subunit 6 [Cucumis melo var. makuwa] >ASY96831.1 NADH dehydrogenase subunit 6 [Cucumis melo var. momordica] >ASY96918.1 NADH dehydrogenase subunit 6 [Cucumis melo var. dudaim] >ASY97005.1 NADH dehydrogenase subunit 6 [Cucumis melo var. cantalupo] >ASY97179.1 NADH dehydrogenase subunit 6 [Cucumis melo var. inodorus] >ASY97353.1 NADH dehydrogenase subunit 6 [Cucumis melo var. flexuosus] >QJF46439.1 NADH dehydrogenase subunit 6 [Cucumis melo]) HSP 1 Score: 112.8 bits (281), Expect = 1.3e-21 Identity = 68/79 (86.08%), Postives = 70/79 (88.61%), Query Frame = 0
BLAST of Cmc06g0167391 vs. ExPASy Swiss-Prot
Match: Q2QD38 (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Cucumis sativus OX=3659 GN=ndhG PE=3 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 1.7e-24 Identity = 68/79 (86.08%), Postives = 70/79 (88.61%), Query Frame = 0
BLAST of Cmc06g0167391 vs. ExPASy Swiss-Prot
Match: Q9M3I8 (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Spinacia oleracea OX=3562 GN=ndhG PE=3 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 9.9e-20 Identity = 58/76 (76.32%), Postives = 63/76 (82.89%), Query Frame = 0
BLAST of Cmc06g0167391 vs. ExPASy Swiss-Prot
Match: A7Y3L7 (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Ipomoea purpurea OX=4121 GN=ndhG PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.2e-19 Identity = 58/79 (73.42%), Postives = 65/79 (82.28%), Query Frame = 0
BLAST of Cmc06g0167391 vs. ExPASy Swiss-Prot
Match: Q09MC3 (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Citrus sinensis OX=2711 GN=ndhG PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 2.9e-19 Identity = 56/79 (70.89%), Postives = 64/79 (81.01%), Query Frame = 0
BLAST of Cmc06g0167391 vs. ExPASy Swiss-Prot
Match: B2XWJ4 (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Fagopyrum esculentum subsp. ancestrale OX=180217 GN=ndhG PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 2.9e-19 Identity = 57/79 (72.15%), Postives = 64/79 (81.01%), Query Frame = 0
BLAST of Cmc06g0167391 vs. ExPASy TrEMBL
Match: A0A218KG81 (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Cucumis sativus var. hardwickii OX=319220 GN=ndhG PE=3 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 6.4e-22 Identity = 68/79 (86.08%), Postives = 70/79 (88.61%), Query Frame = 0
BLAST of Cmc06g0167391 vs. ExPASy TrEMBL
Match: A0A6H0ET31 (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Trichosanthes kirilowii OX=3677 GN=ndhG PE=3 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 6.4e-22 Identity = 68/79 (86.08%), Postives = 70/79 (88.61%), Query Frame = 0
BLAST of Cmc06g0167391 vs. ExPASy TrEMBL
Match: A0A1X9Q1H7 (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Cucumis sativus OX=3659 GN=ndhG PE=3 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 6.4e-22 Identity = 68/79 (86.08%), Postives = 70/79 (88.61%), Query Frame = 0
BLAST of Cmc06g0167391 vs. ExPASy TrEMBL
Match: A0A249RZE0 (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Cucumis melo var. cantalupensis OX=3658 GN=ndhG PE=3 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 6.4e-22 Identity = 68/79 (86.08%), Postives = 70/79 (88.61%), Query Frame = 0
BLAST of Cmc06g0167391 vs. ExPASy TrEMBL
Match: A0A1S4EU65 (NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic OS=Cucumis melo OX=3656 GN=ndhG PE=3 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 6.4e-22 Identity = 68/79 (86.08%), Postives = 70/79 (88.61%), Query Frame = 0
BLAST of Cmc06g0167391 vs. TAIR 10
Match: ATCG01080.1 (NADH:ubiquinone/plastoquinone oxidoreductase, chain 6 ) HSP 1 Score: 87.4 bits (215), Expect = 5.6e-18 Identity = 53/79 (67.09%), Postives = 61/79 (77.22%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|