Cmc04g0107221 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAGATGAGATGGAGTCTTTACATGTAAACCACACTTTTAAGCTTAAGTTGCTCAAAGGAAAAACTGCACTGAAAAATAAATGCGTTTACAGAATTAAACATGAAGAACATACCTCAAAGCCACGTTACAAAGCGAGATTTGTTGTTAAAGGGTTCAGTCAGAAGAAAGGTATCGGTTTTGATGAAAATTTTGCTCCTATTGTCAAGATGTCCTCCATACGTGTCGGTTTGGGTTTGGCAGCTAATCTTGGCTTAGAGGTTGAGCAAATGGATGTTAAGACTGCATTTCTTCATAGGAATTTAGATAAAGAAATCTATATGGAACAACCAAAGGGTTTTTAA ATGAAAGATGAGATGGAGTCTTTACATGTAAACCACACTTTTAAGCTTAAGTTGCTCAAAGGAAAAACTGCACTGAAAAATAAATGCGTTTACAGAATTAAACATGAAGAACATACCTCAAAGCCACGTTACAAAGCGAGATTTGTTGTTAAAGGGTTCAGTCAGAAGAAAGGTATCGGTTTTGATGAAAATTTTGCTCCTATTGTCAAGATGTCCTCCATACGTGTCGGTTTGGGTTTGGCAGCTAATCTTGGCTTAGAGGTTGAGCAAATGGATGTTAAGACTGCATTTCTTCATAGGAATTTAGATAAAGAAATCTATATGGAACAACCAAAGGGTTTTTAA ATGAAAGATGAGATGGAGTCTTTACATGTAAACCACACTTTTAAGCTTAAGTTGCTCAAAGGAAAAACTGCACTGAAAAATAAATGCGTTTACAGAATTAAACATGAAGAACATACCTCAAAGCCACGTTACAAAGCGAGATTTGTTGTTAAAGGGTTCAGTCAGAAGAAAGGTATCGGTTTTGATGAAAATTTTGCTCCTATTGTCAAGATGTCCTCCATACGTGTCGGTTTGGGTTTGGCAGCTAATCTTGGCTTAGAGGTTGAGCAAATGGATGTTAAGACTGCATTTCTTCATAGGAATTTAGATAAAGAAATCTATATGGAACAACCAAAGGGTTTTTAA MKDEMESLHVNHTFKLKLLKGKTALKNKCVYRIKHEEHTSKPRYKARFVVKGFSQKKGIGFDENFAPIVKMSSIRVGLGLAANLGLEVEQMDVKTAFLHRNLDKEIYMEQPKGF Homology
BLAST of Cmc04g0107221 vs. NCBI nr
Match: KAA0065507.1 (putative retrotransposon [Cucumis melo var. makuwa] >TYK08747.1 putative retrotransposon [Cucumis melo var. makuwa]) HSP 1 Score: 223.8 bits (569), Expect = 7.6e-55 Identity = 113/115 (98.26%), Postives = 113/115 (98.26%), Query Frame = 0
BLAST of Cmc04g0107221 vs. NCBI nr
Match: KAA0040427.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 179.1 bits (453), Expect = 2.2e-41 Identity = 94/115 (81.74%), Postives = 101/115 (87.83%), Query Frame = 0
BLAST of Cmc04g0107221 vs. NCBI nr
Match: TYJ98688.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 179.1 bits (453), Expect = 2.2e-41 Identity = 94/115 (81.74%), Postives = 101/115 (87.83%), Query Frame = 0
BLAST of Cmc04g0107221 vs. NCBI nr
Match: CAN77602.1 (hypothetical protein VITISV_024474 [Vitis vinifera]) HSP 1 Score: 176.8 bits (447), Expect = 1.1e-40 Identity = 90/115 (78.26%), Postives = 102/115 (88.70%), Query Frame = 0
BLAST of Cmc04g0107221 vs. NCBI nr
Match: RVW85908.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Vitis vinifera]) HSP 1 Score: 176.0 bits (445), Expect = 1.8e-40 Identity = 89/115 (77.39%), Postives = 103/115 (89.57%), Query Frame = 0
BLAST of Cmc04g0107221 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 2.7e-31 Identity = 73/115 (63.48%), Postives = 90/115 (78.26%), Query Frame = 0
BLAST of Cmc04g0107221 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 87.0 bits (214), Expect = 1.5e-16 Identity = 46/111 (41.44%), Postives = 71/111 (63.96%), Query Frame = 0
BLAST of Cmc04g0107221 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 8.9e-14 Identity = 43/116 (37.07%), Postives = 65/116 (56.03%), Query Frame = 0
BLAST of Cmc04g0107221 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 1.2e-13 Identity = 42/116 (36.21%), Postives = 66/116 (56.90%), Query Frame = 0
BLAST of Cmc04g0107221 vs. ExPASy TrEMBL
Match: A0A5D3C9T7 (Putative retrotransposon OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold76G00580 PE=4 SV=1) HSP 1 Score: 223.8 bits (569), Expect = 3.7e-55 Identity = 113/115 (98.26%), Postives = 113/115 (98.26%), Query Frame = 0
BLAST of Cmc04g0107221 vs. ExPASy TrEMBL
Match: A0A5D3BKF7 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold429G00180 PE=4 SV=1) HSP 1 Score: 179.1 bits (453), Expect = 1.0e-41 Identity = 94/115 (81.74%), Postives = 101/115 (87.83%), Query Frame = 0
BLAST of Cmc04g0107221 vs. ExPASy TrEMBL
Match: A0A5A7TFU1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold35G00580 PE=4 SV=1) HSP 1 Score: 179.1 bits (453), Expect = 1.0e-41 Identity = 94/115 (81.74%), Postives = 101/115 (87.83%), Query Frame = 0
BLAST of Cmc04g0107221 vs. ExPASy TrEMBL
Match: A5C540 (Integrase catalytic domain-containing protein OS=Vitis vinifera OX=29760 GN=VITISV_024474 PE=4 SV=1) HSP 1 Score: 176.8 bits (447), Expect = 5.2e-41 Identity = 90/115 (78.26%), Postives = 102/115 (88.70%), Query Frame = 0
BLAST of Cmc04g0107221 vs. ExPASy TrEMBL
Match: A0A438HN89 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Vitis vinifera OX=29760 GN=POLX_3233 PE=4 SV=1) HSP 1 Score: 176.0 bits (445), Expect = 8.8e-41 Identity = 89/115 (77.39%), Postives = 103/115 (89.57%), Query Frame = 0
BLAST of Cmc04g0107221 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 89.0 bits (219), Expect = 2.7e-18 Identity = 44/115 (38.26%), Postives = 75/115 (65.22%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|