CmUC11G210990 (gene) Watermelon (USVL531) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGCATTGTAATTCTTTCTACTTCTCGGGGTATAATGACAGACCGAGAAGCTCGACTACAGGGAATCGGCGGCGAAATTTTGTGTTATATATGGTAATCTTTATGATATTCGAATTATACACAGAACTTCCCTATTTGTAAAAAAAAAAAAGAGAAGAGGTAGGTTTCTAATACCACTCCCCCTTCATTAATTGATACTTTGAAAGATGTTTCATCTGGAATGAAAGAACAAAAAAGGAGTTCTGAAGGTTTAATTACTGAATCACTTACCAATGGTATGTTTTGGGTTTGTTTAGATAATGAGGATCCAATTCTAGGTTACGTTTCAGGAAGGATTCGACATAGTTTTATCCATATACTAGGTCATAGAGAGTCAAACTTTCAGTAAGTTGTTACGATTCAACCAGAACCAAAGGGCGTATAATTTAGAGACTACGAAACAAAGGATTAGGTGA ATGGGCATTACCGAGAAGCTCGACTACAGGGAATCGGCGGCGAAATTTTGTGTTATATATGATGTTTCATCTGGAATGAAAGAACAAAAAAGGAGTTCTGAAGGTTTAATTACTGAATCACTTACCAATGGTATGTTTTGGGTTTGTTTAGATAATGAGGATCCAATTCTAGGTTACGTTTCAGGAAGGATTCGACATAGTTTTATCCATATACTAGAGAGTCAAACTTTCAGTAAGTTGTTACGATTCAACCAGAACCAAAGGGCGTATAATTTAGAGACTACGAAACAAAGGATTAGGTGA ATGGGCATTACCGAGAAGCTCGACTACAGGGAATCGGCGGCGAAATTTTGTGTTATATATGATGTTTCATCTGGAATGAAAGAACAAAAAAGGAGTTCTGAAGGTTTAATTACTGAATCACTTACCAATGGTATGTTTTGGGTTTGTTTAGATAATGAGGATCCAATTCTAGGTTACGTTTCAGGAAGGATTCGACATAGTTTTATCCATATACTAGAGAGTCAAACTTTCAGTAAGTTGTTACGATTCAACCAGAACCAAAGGGCGTATAATTTAGAGACTACGAAACAAAGGATTAGGTGA MGITEKLDYRESAAKFCVIYDVSSGMKEQKRSSEGLITESLTNGMFWVCLDNEDPILGYVSGRIRHSFIHILESQTFSKLLRFNQNQRAYNLETTKQRIR Homology
BLAST of CmUC11G210990 vs. NCBI nr
Match: YP_009326024.1 (translation initiation factor 1 [Citrullus lanatus] >YP_009348066.1 translation initiation factor 1 [Citrullus mucosospermus] >YP_009431591.1 translation initiation factor 1 [Citrullus amarus] >APW82497.1 translation initiation factor 1 [Citrullus lanatus subsp. vulgaris] >QZL38716.1 translational initiation factor 1 [Citrullus ecirrhosus] >APD52515.1 translation initiation factor 1 [Citrullus lanatus] >APW82582.1 translation initiation factor 1 [Citrullus lanatus subsp. vulgaris] >APW82667.1 translation initiation factor 1 [Citrullus lanatus subsp. vulgaris]) HSP 1 Score: 102.1 bits (253), Expect = 2.9e-18 Identity = 47/47 (100.00%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of CmUC11G210990 vs. NCBI nr
Match: QJF46419.1 (translation initiation factor 1 [Cucumis melo]) HSP 1 Score: 102.1 bits (253), Expect = 2.9e-18 Identity = 48/51 (94.12%), Postives = 49/51 (96.08%), Query Frame = 0
BLAST of CmUC11G210990 vs. NCBI nr
Match: YP_009431677.1 (translation initiation factor 1 [Citrullus rehmii] >ASY96255.1 translation initiation factor 1 [Citrullus rehmii]) HSP 1 Score: 100.5 bits (249), Expect = 8.5e-18 Identity = 46/47 (97.87%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of CmUC11G210990 vs. NCBI nr
Match: QSQ72345.1 (translational initiation factor 1 [Benincasa hispida]) HSP 1 Score: 99.8 bits (247), Expect = 1.5e-17 Identity = 46/47 (97.87%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of CmUC11G210990 vs. NCBI nr
Match: YP_009420829.1 (translation initiation factor 1 [Citrullus colocynthis] >ASP44472.1 translation initiation factor 1 [Citrullus colocynthis]) HSP 1 Score: 97.4 bits (241), Expect = 7.2e-17 Identity = 45/47 (95.74%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of CmUC11G210990 vs. ExPASy Swiss-Prot
Match: A5J1W9 (Translation initiation factor IF-1, chloroplastic OS=Cucumis sativus OX=3659 GN=infA PE=3 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.8e-18 Identity = 43/47 (91.49%), Postives = 44/47 (93.62%), Query Frame = 0
BLAST of CmUC11G210990 vs. ExPASy Swiss-Prot
Match: P30070 (Translation initiation factor IF-1, plastid OS=Epifagus virginiana OX=4177 GN=infA PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 3.5e-14 Identity = 38/47 (80.85%), Postives = 40/47 (85.11%), Query Frame = 0
BLAST of CmUC11G210990 vs. ExPASy Swiss-Prot
Match: P08698 (Translation initiation factor IF-1, chloroplastic OS=Spinacia oleracea OX=3562 GN=infA PE=3 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 4.6e-14 Identity = 39/47 (82.98%), Postives = 39/47 (82.98%), Query Frame = 0
BLAST of CmUC11G210990 vs. ExPASy Swiss-Prot
Match: Q95GN8 (Translation initiation factor IF-1, chloroplastic OS=Cabomba caroliniana OX=4426 GN=infA PE=3 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 7.8e-14 Identity = 38/47 (80.85%), Postives = 39/47 (82.98%), Query Frame = 0
BLAST of CmUC11G210990 vs. ExPASy Swiss-Prot
Match: A1XFZ0 (Translation initiation factor IF-1, chloroplastic OS=Nuphar advena OX=77108 GN=infA PE=3 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 7.8e-14 Identity = 38/47 (80.85%), Postives = 39/47 (82.98%), Query Frame = 0
BLAST of CmUC11G210990 vs. ExPASy TrEMBL
Match: A0A1P8LEB1 (Translation initiation factor 1 OS=Citrullus mucosospermus OX=519315 GN=infA PE=3 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 1.4e-18 Identity = 47/47 (100.00%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of CmUC11G210990 vs. ExPASy TrEMBL
Match: A0A1P8LDB8 (Translation initiation factor 1 OS=Citrullus lanatus subsp. vulgaris OX=260674 GN=infA PE=3 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 1.4e-18 Identity = 47/47 (100.00%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of CmUC11G210990 vs. ExPASy TrEMBL
Match: A0A343A8E5 (Translation initiation factor 1 OS=Citrullus lanatus OX=3654 GN=infA PE=3 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 1.4e-18 Identity = 47/47 (100.00%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of CmUC11G210990 vs. ExPASy TrEMBL
Match: A0A249RX03 (Translation initiation factor 1 OS=Citrullus amarus OX=1567104 GN=infA PE=3 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 1.4e-18 Identity = 47/47 (100.00%), Postives = 47/47 (100.00%), Query Frame = 0
BLAST of CmUC11G210990 vs. ExPASy TrEMBL
Match: A0A6M3W0K7 (Translation initiation factor 1 OS=Cucumis melo OX=3656 GN=infA PE=3 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 1.4e-18 Identity = 48/51 (94.12%), Postives = 49/51 (96.08%), Query Frame = 0
BLAST of CmUC11G210990 vs. TAIR 10
Match: AT4G11175.1 (Nucleic acid-binding, OB-fold-like protein ) HSP 1 Score: 55.5 bits (132), Expect = 2.9e-08 Identity = 26/39 (66.67%), Postives = 31/39 (79.49%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL531) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|