CmUC08G151060 (gene) Watermelon (USVL531) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGTAAACAAGCAAACCTCTTTGCCTCACAAGGAGGGCCAATAATCTTAGCTCAAATTGAGAATGAATATGGAAACGTGATGACACCTTGTGGAAATGCAGGAAAAACATATATAAATTGGTGTACTCAAATGGCTGAATCTCTTAATGTTAGTGTTCCATGGATCATGTGCCAACAGAATGATGCCCCACAACCAATCATTAATACATGCAATGGACACTATTGTAACAACTTTACTCCTAACAATCCTAATAACCCAAAAATGTTTACTGAAAATTGGGTGGGATGGTTCAAGAAATGGGGCGATAAAGACCCTCATAGAACTGCTGAAGACGTAGCATTTTCTGTGGCTTGA ATGTGTAAACAAGCAAACCTCTTTGCCTCACAAGGAGGGCCAATAATCTTAGCTCAAATTGAGAATGAATATGGAAACGTGATGACACCTTGTGGAAATGCAGGAAAAACATATATAAATTGGTGTACTCAAATGGCTGAATCTCTTAATGTTAGTGTTCCATGGATCATGTGCCAACAGAATGATGCCCCACAACCAATCATTAATACATGCAATGGACACTATTGTAACAACTTTACTCCTAACAATCCTAATAACCCAAAAATGTTTACTGAAAATTGGGTGGGATGGTTCAAGAAATGGGGCGATAAAGACCCTCATAGAACTGCTGAAGACGTAGCATTTTCTGTGGCTTGA ATGTGTAAACAAGCAAACCTCTTTGCCTCACAAGGAGGGCCAATAATCTTAGCTCAAATTGAGAATGAATATGGAAACGTGATGACACCTTGTGGAAATGCAGGAAAAACATATATAAATTGGTGTACTCAAATGGCTGAATCTCTTAATGTTAGTGTTCCATGGATCATGTGCCAACAGAATGATGCCCCACAACCAATCATTAATACATGCAATGGACACTATTGTAACAACTTTACTCCTAACAATCCTAATAACCCAAAAATGTTTACTGAAAATTGGGTGGGATGGTTCAAGAAATGGGGCGATAAAGACCCTCATAGAACTGCTGAAGACGTAGCATTTTCTGTGGCTTGA MCKQANLFASQGGPIILAQIENEYGNVMTPCGNAGKTYINWCTQMAESLNVSVPWIMCQQNDAPQPIINTCNGHYCNNFTPNNPNNPKMFTENWVGWFKKWGDKDPHRTAEDVAFSVA Homology
BLAST of CmUC08G151060 vs. NCBI nr
Match: XP_008459141.1 (PREDICTED: beta-galactosidase 15-like [Cucumis melo]) HSP 1 Score: 248.8 bits (634), Expect = 2.3e-62 Identity = 110/118 (93.22%), Postives = 114/118 (96.61%), Query Frame = 0
BLAST of CmUC08G151060 vs. NCBI nr
Match: KAA0045403.1 (beta-galactosidase-like [Cucumis melo var. makuwa] >TYK11334.1 beta-galactosidase-like [Cucumis melo var. makuwa]) HSP 1 Score: 248.8 bits (634), Expect = 2.3e-62 Identity = 110/118 (93.22%), Postives = 114/118 (96.61%), Query Frame = 0
BLAST of CmUC08G151060 vs. NCBI nr
Match: XP_008464891.1 (PREDICTED: beta-galactosidase-like [Cucumis melo]) HSP 1 Score: 248.8 bits (634), Expect = 2.3e-62 Identity = 110/118 (93.22%), Postives = 114/118 (96.61%), Query Frame = 0
BLAST of CmUC08G151060 vs. NCBI nr
Match: XP_008447673.1 (PREDICTED: beta-galactosidase 15-like [Cucumis melo] >KAA0038152.1 beta-galactosidase 15-like [Cucumis melo var. makuwa] >TYK20451.1 beta-galactosidase 15-like [Cucumis melo var. makuwa]) HSP 1 Score: 246.9 bits (629), Expect = 8.7e-62 Identity = 108/118 (91.53%), Postives = 113/118 (95.76%), Query Frame = 0
BLAST of CmUC08G151060 vs. NCBI nr
Match: XP_011652808.2 (beta-galactosidase-like [Cucumis sativus]) HSP 1 Score: 246.9 bits (629), Expect = 8.7e-62 Identity = 108/118 (91.53%), Postives = 113/118 (95.76%), Query Frame = 0
BLAST of CmUC08G151060 vs. ExPASy Swiss-Prot
Match: Q9C6W4 (Beta-galactosidase 15 OS=Arabidopsis thaliana OX=3702 GN=BGAL15 PE=2 SV=1) HSP 1 Score: 206.1 bits (523), Expect = 2.2e-52 Identity = 88/118 (74.58%), Postives = 100/118 (84.75%), Query Frame = 0
BLAST of CmUC08G151060 vs. ExPASy Swiss-Prot
Match: P49676 (Beta-galactosidase OS=Brassica oleracea OX=3712 PE=2 SV=1) HSP 1 Score: 188.7 bits (478), Expect = 3.7e-47 Identity = 81/118 (68.64%), Postives = 97/118 (82.20%), Query Frame = 0
BLAST of CmUC08G151060 vs. ExPASy Swiss-Prot
Match: Q9SCV5 (Beta-galactosidase 7 OS=Arabidopsis thaliana OX=3702 GN=BGAL7 PE=2 SV=2) HSP 1 Score: 186.8 bits (473), Expect = 1.4e-46 Identity = 79/118 (66.95%), Postives = 95/118 (80.51%), Query Frame = 0
BLAST of CmUC08G151060 vs. ExPASy Swiss-Prot
Match: Q9SCV4 (Beta-galactosidase 8 OS=Arabidopsis thaliana OX=3702 GN=BGAL8 PE=2 SV=2) HSP 1 Score: 167.9 bits (424), Expect = 6.7e-41 Identity = 74/118 (62.71%), Postives = 89/118 (75.42%), Query Frame = 0
BLAST of CmUC08G151060 vs. ExPASy Swiss-Prot
Match: Q10NX8 (Beta-galactosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0255100 PE=1 SV=2) HSP 1 Score: 167.5 bits (423), Expect = 8.8e-41 Identity = 73/116 (62.93%), Postives = 90/116 (77.59%), Query Frame = 0
BLAST of CmUC08G151060 vs. ExPASy TrEMBL
Match: A0A5A7TPD9 (Beta-galactosidase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold807G00080 PE=3 SV=1) HSP 1 Score: 248.8 bits (634), Expect = 1.1e-62 Identity = 110/118 (93.22%), Postives = 114/118 (96.61%), Query Frame = 0
BLAST of CmUC08G151060 vs. ExPASy TrEMBL
Match: A0A1S3CP45 (Beta-galactosidase OS=Cucumis melo OX=3656 GN=LOC103502650 PE=3 SV=1) HSP 1 Score: 248.8 bits (634), Expect = 1.1e-62 Identity = 110/118 (93.22%), Postives = 114/118 (96.61%), Query Frame = 0
BLAST of CmUC08G151060 vs. ExPASy TrEMBL
Match: A0A1S3C8Z9 (Beta-galactosidase OS=Cucumis melo OX=3656 GN=LOC103498345 PE=3 SV=1) HSP 1 Score: 248.8 bits (634), Expect = 1.1e-62 Identity = 110/118 (93.22%), Postives = 114/118 (96.61%), Query Frame = 0
BLAST of CmUC08G151060 vs. ExPASy TrEMBL
Match: A0A5D3DA46 (Beta-galactosidase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold237G00180 PE=3 SV=1) HSP 1 Score: 246.9 bits (629), Expect = 4.2e-62 Identity = 108/118 (91.53%), Postives = 113/118 (95.76%), Query Frame = 0
BLAST of CmUC08G151060 vs. ExPASy TrEMBL
Match: A0A0A0LDH9 (Beta-galactosidase OS=Cucumis sativus OX=3659 GN=Csa_3G550690 PE=3 SV=1) HSP 1 Score: 246.9 bits (629), Expect = 4.2e-62 Identity = 108/118 (91.53%), Postives = 113/118 (95.76%), Query Frame = 0
BLAST of CmUC08G151060 vs. TAIR 10
Match: AT1G31740.1 (beta-galactosidase 15 ) HSP 1 Score: 206.1 bits (523), Expect = 1.6e-53 Identity = 88/118 (74.58%), Postives = 100/118 (84.75%), Query Frame = 0
BLAST of CmUC08G151060 vs. TAIR 10
Match: AT5G20710.1 (beta-galactosidase 7 ) HSP 1 Score: 186.8 bits (473), Expect = 1.0e-47 Identity = 79/118 (66.95%), Postives = 95/118 (80.51%), Query Frame = 0
BLAST of CmUC08G151060 vs. TAIR 10
Match: AT2G28470.1 (beta-galactosidase 8 ) HSP 1 Score: 167.9 bits (424), Expect = 4.8e-42 Identity = 74/118 (62.71%), Postives = 89/118 (75.42%), Query Frame = 0
BLAST of CmUC08G151060 vs. TAIR 10
Match: AT2G28470.2 (beta-galactosidase 8 ) HSP 1 Score: 167.9 bits (424), Expect = 4.8e-42 Identity = 74/118 (62.71%), Postives = 89/118 (75.42%), Query Frame = 0
BLAST of CmUC08G151060 vs. TAIR 10
Match: AT5G63810.1 (beta-galactosidase 10 ) HSP 1 Score: 165.6 bits (418), Expect = 2.4e-41 Identity = 72/118 (61.02%), Postives = 86/118 (72.88%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL531) v1
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|