ClCG01G010440 (gene) Watermelon (Charleston Gray) v2.5
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TTCAAACTTGATCACAATGGCTAGATCTCTTTTCTTCATTGTGTCTCTTCTCCTCTTTGTGTCGATGTTGTCGGTCACAGCAACAAGGTCACGGTTAGATTTGGTCGGTGGCTATGAACCAATAAAGAGCATAGATGATCCACATATCCAAAGCCTAGGAGAGTTTGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAGAAAGTGATTAGTGGAAAATTACAGATTGTGTCTGGGACCAACTACGACCTTCGATTAATGGCTCTTGAGGGGACTGTAAGCAGAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGGCCTCTCTAACTAAGCTTTCTTTTGCTTCTCATCAATAACTATGT TTCAAACTTGATCACAATGGCTAGATCTCTTTTCTTCATTGTGTCTCTTCTCCTCTTTGTGTCGATGTTGTCGGTCACAGCAACAAGGTCACGGTTAGATTTGGTCGGTGGCTATGAACCAATAAAGAGCATAGATGATCCACATATCCAAAGCCTAGGAGAGTTTGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAGAAAGTGATTAGTGGAAAATTACAGATTGTGTCTGGGACCAACTACGACCTTCGATTAATGGCTCTTGAGGGGACTGTAAGCAGAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGGCCTCTCTAACTAAGCTTTCTTTTGCTTCTCATCAATAACTATGT ATGGCTAGATCTCTTTTCTTCATTGTGTCTCTTCTCCTCTTTGTGTCGATGTTGTCGGTCACAGCAACAAGGTCACGGTTAGATTTGGTCGGTGGCTATGAACCAATAAAGAGCATAGATGATCCACATATCCAAAGCCTAGGAGAGTTTGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAGAAAGTGATTAGTGGAAAATTACAGATTGTGTCTGGGACCAACTACGACCTTCGATTAATGGCTCTTGAGGGGACTGTAAGCAGAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGGCCTCTCTAACTAA MARSLFFIVSLLLFVSMLSVTATRSRLDLVGGYEPIKSIDDPHIQSLGEFAVNEHNKQAKTQLKFEKVISGKLQIVSGTNYDLRLMALEGTVSRTYGTLVFTDLKNENHLINFYGLSN Homology
BLAST of ClCG01G010440 vs. NCBI nr
Match: XP_038895825.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 193.7 bits (491), Expect = 8.7e-46 Identity = 100/119 (84.03%), Postives = 111/119 (93.28%), Query Frame = 0
BLAST of ClCG01G010440 vs. NCBI nr
Match: XP_004151251.1 (cysteine proteinase inhibitor 5 [Cucumis sativus]) HSP 1 Score: 182.2 bits (461), Expect = 2.6e-42 Identity = 95/119 (79.83%), Postives = 107/119 (89.92%), Query Frame = 0
BLAST of ClCG01G010440 vs. NCBI nr
Match: KAE8652869.1 (hypothetical protein Csa_013019 [Cucumis sativus]) HSP 1 Score: 182.2 bits (461), Expect = 2.6e-42 Identity = 95/119 (79.83%), Postives = 107/119 (89.92%), Query Frame = 0
BLAST of ClCG01G010440 vs. NCBI nr
Match: XP_038895826.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 178.7 bits (452), Expect = 2.9e-41 Identity = 92/114 (80.70%), Postives = 104/114 (91.23%), Query Frame = 0
BLAST of ClCG01G010440 vs. NCBI nr
Match: TYK30896.1 (cysteine proteinase inhibitor 1 [Cucumis melo var. makuwa]) HSP 1 Score: 175.3 bits (443), Expect = 3.2e-40 Identity = 89/112 (79.46%), Postives = 102/112 (91.07%), Query Frame = 0
BLAST of ClCG01G010440 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 78.6 bits (192), Expect = 5.4e-14 Identity = 44/102 (43.14%), Postives = 69/102 (67.65%), Query Frame = 0
BLAST of ClCG01G010440 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 3.9e-12 Identity = 39/95 (41.05%), Postives = 61/95 (64.21%), Query Frame = 0
BLAST of ClCG01G010440 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 70.5 bits (171), Expect = 1.5e-11 Identity = 35/94 (37.23%), Postives = 59/94 (62.77%), Query Frame = 0
BLAST of ClCG01G010440 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.5e-11 Identity = 41/100 (41.00%), Postives = 61/100 (61.00%), Query Frame = 0
BLAST of ClCG01G010440 vs. ExPASy Swiss-Prot
Match: Q84WT8 (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 67.0 bits (162), Expect = 1.6e-10 Identity = 30/79 (37.97%), Postives = 52/79 (65.82%), Query Frame = 0
BLAST of ClCG01G010440 vs. ExPASy TrEMBL
Match: A0A0A0LYM0 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G183070 PE=4 SV=1) HSP 1 Score: 182.2 bits (461), Expect = 1.3e-42 Identity = 95/119 (79.83%), Postives = 107/119 (89.92%), Query Frame = 0
BLAST of ClCG01G010440 vs. ExPASy TrEMBL
Match: A0A5D3E5H4 (Cysteine proteinase inhibitor 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold455G001040 PE=4 SV=1) HSP 1 Score: 175.3 bits (443), Expect = 1.6e-40 Identity = 89/112 (79.46%), Postives = 102/112 (91.07%), Query Frame = 0
BLAST of ClCG01G010440 vs. ExPASy TrEMBL
Match: A0A6J1IJX9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475533 PE=4 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 3.8e-39 Identity = 87/119 (73.11%), Postives = 104/119 (87.39%), Query Frame = 0
BLAST of ClCG01G010440 vs. ExPASy TrEMBL
Match: A0A5A7T201 (Cysteine proteinase inhibitor 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold285G003390 PE=4 SV=1) HSP 1 Score: 170.2 bits (430), Expect = 5.0e-39 Identity = 82/102 (80.39%), Postives = 94/102 (92.16%), Query Frame = 0
BLAST of ClCG01G010440 vs. ExPASy TrEMBL
Match: A0A6J1IC30 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111471626 PE=4 SV=1) HSP 1 Score: 166.8 bits (421), Expect = 5.5e-38 Identity = 85/118 (72.03%), Postives = 102/118 (86.44%), Query Frame = 0
BLAST of ClCG01G010440 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 78.6 bits (192), Expect = 3.8e-15 Identity = 44/102 (43.14%), Postives = 69/102 (67.65%), Query Frame = 0
BLAST of ClCG01G010440 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 67.0 bits (162), Expect = 1.1e-11 Identity = 30/79 (37.97%), Postives = 52/79 (65.82%), Query Frame = 0
BLAST of ClCG01G010440 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 52.8 bits (125), Expect = 2.2e-07 Identity = 38/106 (35.85%), Postives = 57/106 (53.77%), Query Frame = 0
BLAST of ClCG01G010440 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 52.4 bits (124), Expect = 2.9e-07 Identity = 34/107 (31.78%), Postives = 57/107 (53.27%), Query Frame = 0
BLAST of ClCG01G010440 vs. TAIR 10
Match: AT5G12140.1 (cystatin-1 ) HSP 1 Score: 51.2 bits (121), Expect = 6.5e-07 Identity = 28/90 (31.11%), Postives = 49/90 (54.44%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (Charleston Gray) v2.5
Date Performed: 2022-01-31
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|