
Chy2G036040 (gene) Cucumber (hystrix) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATGCTGATGTGATCACCATTGAGAATTCCAGATCAGATGAGAAGCTCCTGTCTGTCTTCTGCGAGGGAGTAAAATACGGTGCTGGAATTGCTAGACGAGATCAACAAGATGCTCGCTGTTCTGAAAAGCAACATCCTCAGGTGAACCCTGACTACGGTCTTAAAACCCGAAAGTACACTGAAGTCAAGCCTATCCTCCTCAACATGGTTGCTGCTGCTAAGCTCCTTCGCTCACAATTGGCCAGTGCCTAG ATGGATGCTGATGTGATCACCATTGAGAATTCCAGATCAGATGAGAAGCTCCTGTCTGTCTTCTGCGAGGGAGTAAAATACGGTGCTGGAATTGCTAGACGAGATCAACAAGATGCTCGCTGTTCTGAAAAGCAACATCCTCAGGTGAACCCTGACTACGGTCTTAAAACCCGAAAGTACACTGAAGTCAAGCCTATCCTCCTCAACATGGTTGCTGCTGCTAAGCTCCTTCGCTCACAATTGGCCAGTGCCTAG ATGGATGCTGATGTGATCACCATTGAGAATTCCAGATCAGATGAGAAGCTCCTGTCTGTCTTCTGCGAGGGAGTAAAATACGGTGCTGGAATTGCTAGACGAGATCAACAAGATGCTCGCTGTTCTGAAAAGCAACATCCTCAGGTGAACCCTGACTACGGTCTTAAAACCCGAAAGTACACTGAAGTCAAGCCTATCCTCCTCAACATGGTTGCTGCTGCTAAGCTCCTTCGCTCACAATTGGCCAGTGCCTAG MDADVITIENSRSDEKLLSVFCEGVKYGAGIARRDQQDARCSEKQHPQVNPDYGLKTRKYTEVKPILLNMVAAAKLLRSQLASA* Homology
BLAST of Chy2G036040 vs. ExPASy Swiss-Prot
Match: O50008 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=MS1 PE=1 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.9e-21 Identity = 64/102 (62.75%), Postives = 67/102 (65.69%), Query Frame = 0
BLAST of Chy2G036040 vs. ExPASy Swiss-Prot
Match: Q42662 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Plectranthus scutellarioides OX=4142 GN=MET PE=1 SV=2) HSP 1 Score: 101.7 bits (252), Expect = 4.3e-21 Identity = 64/102 (62.75%), Postives = 66/102 (64.71%), Query Frame = 0
BLAST of Chy2G036040 vs. ExPASy Swiss-Prot
Match: Q2QLY4 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=Os12g0624000 PE=2 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 9.5e-21 Identity = 62/102 (60.78%), Postives = 66/102 (64.71%), Query Frame = 0
BLAST of Chy2G036040 vs. ExPASy Swiss-Prot
Match: Q2QLY5 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os12g0623900 PE=2 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 2.1e-20 Identity = 61/102 (59.80%), Postives = 66/102 (64.71%), Query Frame = 0
BLAST of Chy2G036040 vs. ExPASy Swiss-Prot
Match: Q9SRV5 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=MS2 PE=1 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 4.7e-20 Identity = 62/102 (60.78%), Postives = 65/102 (63.73%), Query Frame = 0
BLAST of Chy2G036040 vs. ExPASy TrEMBL
Match: A0A5A7UQ81 (5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold181G00930 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 2.2e-20 Identity = 67/102 (65.69%), Postives = 68/102 (66.67%), Query Frame = 0
BLAST of Chy2G036040 vs. ExPASy TrEMBL
Match: A0A5D3CDP2 (5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold16G00800 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 2.2e-20 Identity = 67/102 (65.69%), Postives = 68/102 (66.67%), Query Frame = 0
BLAST of Chy2G036040 vs. ExPASy TrEMBL
Match: A0A0A0LZR2 (5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase OS=Cucumis sativus OX=3659 GN=Csa_1G599580 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 2.2e-20 Identity = 67/102 (65.69%), Postives = 68/102 (66.67%), Query Frame = 0
BLAST of Chy2G036040 vs. ExPASy TrEMBL
Match: A0A1S3BQJ8 (5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase OS=Cucumis melo OX=3656 GN=LOC103492431 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 2.2e-20 Identity = 67/102 (65.69%), Postives = 68/102 (66.67%), Query Frame = 0
BLAST of Chy2G036040 vs. ExPASy TrEMBL
Match: A0A7J0FHV5 (Cobalamin-independent synthase family protein OS=Actinidia rufa OX=165716 GN=Acr_12g0005670 PE=4 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 6.4e-20 Identity = 65/102 (63.73%), Postives = 69/102 (67.65%), Query Frame = 0
BLAST of Chy2G036040 vs. NCBI nr
Match: GFY98026.1 (cobalamin-independent synthase family protein [Actinidia rufa]) HSP 1 Score: 106 bits (264), Expect = 2.08e-27 Identity = 65/102 (63.73%), Postives = 69/102 (67.65%), Query Frame = 0
BLAST of Chy2G036040 vs. NCBI nr
Match: GAU34286.1 (hypothetical protein TSUD_19910 [Trifolium subterraneum]) HSP 1 Score: 103 bits (258), Expect = 2.38e-26 Identity = 59/88 (67.05%), Postives = 66/88 (75.00%), Query Frame = 0
BLAST of Chy2G036040 vs. NCBI nr
Match: KAF2562078.1 (hypothetical protein F2Q70_00014449 [Brassica cretica]) HSP 1 Score: 103 bits (257), Expect = 2.41e-26 Identity = 64/102 (62.75%), Postives = 67/102 (65.69%), Query Frame = 0
BLAST of Chy2G036040 vs. NCBI nr
Match: KAF3551807.1 (hypothetical protein DY000_02000750 [Brassica cretica]) HSP 1 Score: 102 bits (255), Expect = 3.17e-26 Identity = 64/102 (62.75%), Postives = 67/102 (65.69%), Query Frame = 0
BLAST of Chy2G036040 vs. NCBI nr
Match: KAF4360247.1 (hypothetical protein F8388_020538 [Cannabis sativa]) HSP 1 Score: 105 bits (261), Expect = 7.18e-26 Identity = 66/102 (64.71%), Postives = 67/102 (65.69%), Query Frame = 0
BLAST of Chy2G036040 vs. TAIR 10
Match: AT5G17920.1 (Cobalamin-independent synthase family protein ) HSP 1 Score: 102.8 bits (255), Expect = 1.4e-22 Identity = 64/102 (62.75%), Postives = 67/102 (65.69%), Query Frame = 0
BLAST of Chy2G036040 vs. TAIR 10
Match: AT5G17920.2 (Cobalamin-independent synthase family protein ) HSP 1 Score: 102.8 bits (255), Expect = 1.4e-22 Identity = 64/102 (62.75%), Postives = 67/102 (65.69%), Query Frame = 0
BLAST of Chy2G036040 vs. TAIR 10
Match: AT3G03780.1 (methionine synthase 2 ) HSP 1 Score: 98.2 bits (243), Expect = 3.4e-21 Identity = 62/102 (60.78%), Postives = 65/102 (63.73%), Query Frame = 0
BLAST of Chy2G036040 vs. TAIR 10
Match: AT3G03780.2 (methionine synthase 2 ) HSP 1 Score: 98.2 bits (243), Expect = 3.4e-21 Identity = 62/102 (60.78%), Postives = 65/102 (63.73%), Query Frame = 0
BLAST of Chy2G036040 vs. TAIR 10
Match: AT3G03780.3 (methionine synthase 2 ) HSP 1 Score: 98.2 bits (243), Expect = 3.4e-21 Identity = 62/102 (60.78%), Postives = 65/102 (63.73%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (hystrix) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|