
Chy11G187410 (gene) Cucumber (hystrix) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAAATGTGTCACTCTTCGATAATGAGATCTCAGGAAAAAGGATTGTAGCCTTTGGTATAATTGGCCAAAGGTCAGTGTGATGAGTCTTGAGGCAGATATTGGGGCTTTCGGTATATATGATTGAAGGCCAATACATTGAGTCATTGAGTTTTTGGGTATAAATGGTCAAGGGACTTGAGGCCTCAGGTATAAATAGTTAAGGATCAAACATTGAGTTCTTTAGAGCAGTGTGGAAGAGTTTGATACGGGAGAATGCTAGAAAGAGTCATGGGGACTCGGTGATGTTTGAGAAAGTTTGGGATGAGCATGCATGATGATATAATTTAGATCACGAGTTGAATAGTTAATAAAGTCACACATATTATTCATTTTCGTATATGCTGTATTGTATGAGTAACTTGCATTTGAGAAGCATGTTTTGATGTATGTTATACGTTGTTTGTCACTCGTTAGGTGGAAGCTAGTTACTGAGCAAGAGATGTCGTACTTGCTGCCACATCTTCATTCAGGATGGGCTGTTGACCAGGCAATCCTTGCAGAAGAAGAACGTCTTGTGGTCATTCGTTTCGGTCATGATTGGGATGAAACTTGTATGCAGGTCTTTATCTCTTCCATTCCATAATCTTCCATTCCTCTTTCTCAGCATAATTGGTTCATCATCAAATTTAATGTTGACCATGTTGTGTGTCTCTCTCTCTCTGAACTTCTTTATTCTTCTTCTTGCTTCCAACGAACTGAGTTTATTTTGTTCTGGTTTTTAGTTTCACAAAAAAAGTTTCTATCATCGTGTGTTCTGGTGCAACTGTGCTTCTGGCAAGTTCTCTATAATCATGCGTTCCTACTTGTTTTTAGTATGTAGTATGTACCAAAGATGAAGTTTCTTCATCCCAGTTATGAACTATGATTTTTTTGGTGCATGATTTGTTTTGAATCCTTTTCCCTCTTTTTATGTTAAATATGATCACAGTTCTTCTATCTTACATGTTAAAGATTGGGAAGATGAAGATCCTTATGTTTCTTTTTTCTTGAGATGTTTTATCTGATTGAGATGTTTTTGTTGTAGATGGATGAAGTGTTGGCCTCAGTTGCAGAGACGATTAAGAACTTTGCTGTAATATACCTTGTGGATATCACAGAGGTTCCTGATTTCAACACAATGTACGAGCTGTATGATCCATCCACTGTTATGTTCTTCTTTAGGAACAAGCACATAATGATTGATCTTGGTACTGGAAACAACAATAAGATAAACTGGGCACTTAAGGACAAGCAGGAGTTCATTGATATCATTGAAACAGTGTATCGTGGAGCAAGGAAAGGACGTGGTTTAGTCATTGCACCCAAGGACTATTCGACCAAATATCGCTACTAA ATGGAAAATGTGTCACTCTTCGATAATGAGATCTCAGGAAAAAGGATTGTAGCCTTTGGTATAATTGGCCAAAGGTGGAAGCTAGTTACTGAGCAAGAGATGTCGTACTTGCTGCCACATCTTCATTCAGGATGGGCTGTTGACCAGGCAATCCTTGCAGAAGAAGAACGTCTTGTGGTCATTCGTTTCGGTCATGATTGGGATGAAACTTGTATGCAGATGGATGAAGTGTTGGCCTCAGTTGCAGAGACGATTAAGAACTTTGCTGTAATATACCTTGTGGATATCACAGAGGTTCCTGATTTCAACACAATGTACGAGCTGTATGATCCATCCACTGTTATGTTCTTCTTTAGGAACAAGCACATAATGATTGATCTTGGTACTGGAAACAACAATAAGATAAACTGGGCACTTAAGGACAAGCAGGAGTTCATTGATATCATTGAAACAGTGTATCGTGGAGCAAGGAAAGGACGTGGTTTAGTCATTGCACCCAAGGACTATTCGACCAAATATCGCTACTAA ATGGAAAATGTGTCACTCTTCGATAATGAGATCTCAGGAAAAAGGATTGTAGCCTTTGGTATAATTGGCCAAAGGTGGAAGCTAGTTACTGAGCAAGAGATGTCGTACTTGCTGCCACATCTTCATTCAGGATGGGCTGTTGACCAGGCAATCCTTGCAGAAGAAGAACGTCTTGTGGTCATTCGTTTCGGTCATGATTGGGATGAAACTTGTATGCAGATGGATGAAGTGTTGGCCTCAGTTGCAGAGACGATTAAGAACTTTGCTGTAATATACCTTGTGGATATCACAGAGGTTCCTGATTTCAACACAATGTACGAGCTGTATGATCCATCCACTGTTATGTTCTTCTTTAGGAACAAGCACATAATGATTGATCTTGGTACTGGAAACAACAATAAGATAAACTGGGCACTTAAGGACAAGCAGGAGTTCATTGATATCATTGAAACAGTGTATCGTGGAGCAAGGAAAGGACGTGGTTTAGTCATTGCACCCAAGGACTATTCGACCAAATATCGCTACTAA MENVSLFDNEISGKRIVAFGIIGQRWKLVTEQEMSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVIYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIIETVYRGARKGRGLVIAPKDYSTKYRY* Homology
BLAST of Chy11G187410 vs. ExPASy Swiss-Prot
Match: Q9FE62 (Thioredoxin-like protein YLS8 OS=Arabidopsis thaliana OX=3702 GN=YLS8 PE=1 SV=1) HSP 1 Score: 295.8 bits (756), Expect = 3.2e-79 Identity = 141/142 (99.30%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of Chy11G187410 vs. ExPASy Swiss-Prot
Match: P83876 (Thioredoxin-like protein 4A OS=Homo sapiens OX=9606 GN=TXNL4A PE=1 SV=1) HSP 1 Score: 269.6 bits (688), Expect = 2.5e-71 Identity = 122/142 (85.92%), Postives = 135/142 (95.07%), Query Frame = 0
BLAST of Chy11G187410 vs. ExPASy Swiss-Prot
Match: P83877 (Thioredoxin-like protein 4A OS=Mus musculus OX=10090 GN=Txnl4a PE=1 SV=1) HSP 1 Score: 269.6 bits (688), Expect = 2.5e-71 Identity = 122/142 (85.92%), Postives = 135/142 (95.07%), Query Frame = 0
BLAST of Chy11G187410 vs. ExPASy Swiss-Prot
Match: P87215 (Mitosis protein dim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dim1 PE=1 SV=1) HSP 1 Score: 238.0 bits (606), Expect = 7.9e-62 Identity = 109/142 (76.76%), Postives = 126/142 (88.73%), Query Frame = 0
BLAST of Chy11G187410 vs. ExPASy Swiss-Prot
Match: Q75BD8 (Spliceosomal protein DIB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DIB1 PE=3 SV=1) HSP 1 Score: 203.4 bits (516), Expect = 2.2e-51 Identity = 93/138 (67.39%), Postives = 112/138 (81.16%), Query Frame = 0
BLAST of Chy11G187410 vs. ExPASy TrEMBL
Match: A0A5D3BID1 (Thioredoxin-like protein YLS8 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold123G00480 PE=3 SV=1) HSP 1 Score: 315.5 bits (807), Expect = 1.4e-82 Identity = 150/151 (99.34%), Postives = 151/151 (100.00%), Query Frame = 0
BLAST of Chy11G187410 vs. ExPASy TrEMBL
Match: A0A5A7TWZ9 (Thioredoxin-like protein YLS8 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold243G003210 PE=3 SV=1) HSP 1 Score: 314.7 bits (805), Expect = 2.5e-82 Identity = 150/150 (100.00%), Postives = 150/150 (100.00%), Query Frame = 0
BLAST of Chy11G187410 vs. ExPASy TrEMBL
Match: A0A5N6LHX1 (Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_42382 PE=3 SV=1) HSP 1 Score: 300.8 bits (769), Expect = 3.7e-78 Identity = 142/145 (97.93%), Postives = 145/145 (100.00%), Query Frame = 0
BLAST of Chy11G187410 vs. ExPASy TrEMBL
Match: A0A1J3DF14 (Thioredoxin-like protein YLS8 (Fragment) OS=Noccaea caerulescens OX=107243 GN=GA_TR21189_c0_g1_i1_g.70234 PE=3 SV=1) HSP 1 Score: 300.4 bits (768), Expect = 4.8e-78 Identity = 143/152 (94.08%), Postives = 147/152 (96.71%), Query Frame = 0
BLAST of Chy11G187410 vs. ExPASy TrEMBL
Match: A0A1J3IZG5 (Thioredoxin-like protein YLS8 (Fragment) OS=Noccaea caerulescens OX=107243 GN=MP_TR24166_c0_g1_i1_g.70258 PE=3 SV=1) HSP 1 Score: 300.4 bits (768), Expect = 4.8e-78 Identity = 143/152 (94.08%), Postives = 147/152 (96.71%), Query Frame = 0
BLAST of Chy11G187410 vs. NCBI nr
Match: KAA0045799.1 (Thioredoxin-like protein YLS8 [Cucumis melo var. makuwa]) HSP 1 Score: 311 bits (798), Expect = 1.45e-106 Identity = 150/150 (100.00%), Postives = 150/150 (100.00%), Query Frame = 0
BLAST of Chy11G187410 vs. NCBI nr
Match: TYJ99482.1 (Thioredoxin-like protein YLS8 [Cucumis melo var. makuwa]) HSP 1 Score: 312 bits (800), Expect = 1.90e-106 Identity = 150/151 (99.34%), Postives = 151/151 (100.00%), Query Frame = 0
BLAST of Chy11G187410 vs. NCBI nr
Match: RZC56849.1 (hypothetical protein C5167_015697 [Papaver somniferum]) HSP 1 Score: 296 bits (757), Expect = 3.64e-100 Identity = 142/145 (97.93%), Postives = 144/145 (99.31%), Query Frame = 0
BLAST of Chy11G187410 vs. NCBI nr
Match: XP_004148041.1 (thioredoxin-like protein YLS8 [Cucumis sativus] >XP_004497782.1 thioredoxin-like protein YLS8 isoform X2 [Cicer arietinum] >XP_006288859.1 thioredoxin-like protein YLS8 [Capsella rubella] >XP_006399318.1 thioredoxin-like protein YLS8 [Eutrema salsugineum] >XP_008457801.1 PREDICTED: thioredoxin-like protein YLS8 [Cucumis melo] >XP_010452811.1 PREDICTED: thioredoxin-like protein YLS8 [Camelina sativa] >XP_010491455.1 PREDICTED: thioredoxin-like protein YLS8 [Camelina sativa] >XP_012459864.1 PREDICTED: thioredoxin-like protein YLS8 [Gossypium raimondii] >XP_015894288.1 thioredoxin-like protein YLS8 [Ziziphus jujuba] >XP_015961428.1 thioredoxin-like protein YLS8 isoform X1 [Arachis duranensis] >XP_015961429.1 thioredoxin-like protein YLS8 isoform X1 [Arachis duranensis] >XP_016198827.1 thioredoxin-like protein YLS8 isoform X1 [Arachis ipaensis] >XP_016198828.1 thioredoxin-like protein YLS8 isoform X1 [Arachis ipaensis] >XP_016198829.1 thioredoxin-like protein YLS8 isoform X1 [Arachis ipaensis] >XP_016198830.1 thioredoxin-like protein YLS8 isoform X1 [Arachis ipaensis] >XP_016198831.1 thioredoxin-like protein YLS8 isoform X1 [Arachis ipaensis] >XP_017612852.1 PREDICTED: thioredoxin-like protein YLS8 [Gossypium arboreum] >XP_019420159.1 PREDICTED: thioredoxin-like protein YLS8 [Lupinus angustifolius] >XP_019439280.1 PREDICTED: thioredoxin-like protein YLS8 [Lupinus angustifolius] >XP_021632944.1 thioredoxin-like protein YLS8 [Manihot esculenta] >XP_021674120.1 thioredoxin-like protein YLS8 [Hevea brasiliensis] >XP_021674917.1 thioredoxin-like protein YLS8 [Hevea brasiliensis] >XP_022139323.1 thioredoxin-like protein YLS8 isoform X1 [Momordica charantia] >XP_022153368.1 thioredoxin-like protein YLS8 [Momordica charantia] >XP_022153369.1 thioredoxin-like protein YLS8 [Momordica charantia] >XP_022927978.1 thioredoxin-like protein YLS8 [Cucurbita moschata] >XP_022927979.1 thioredoxin-like protein YLS8 [Cucurbita moschata] >XP_022971679.1 thioredoxin-like protein YLS8 [Cucurbita maxima] >XP_022971680.1 thioredoxin-like protein YLS8 [Cucurbita maxima] >XP_023513106.1 thioredoxin-like protein YLS8 isoform X1 [Cucurbita pepo subsp. pepo] >XP_023513107.1 thioredoxin-like protein YLS8 isoform X1 [Cucurbita pepo subsp. pepo] >XP_023513108.1 thioredoxin-like protein YLS8 isoform X1 [Cucurbita pepo subsp. pepo] >XP_024007091.1 thioredoxin-like protein YLS8 [Eutrema salsugineum] >XP_025649101.1 thioredoxin-like protein YLS8 [Arachis hypogaea] >XP_025649102.1 thioredoxin-like protein YLS8 [Arachis hypogaea] >XP_025649103.1 thioredoxin-like protein YLS8 [Arachis hypogaea] >XP_025649104.1 thioredoxin-like protein YLS8 [Arachis hypogaea] >XP_025695902.1 thioredoxin-like protein YLS8 [Arachis hypogaea] >XP_025695903.1 thioredoxin-like protein YLS8 [Arachis hypogaea] >XP_028767038.1 thioredoxin-like protein YLS8 [Prosopis alba] >XP_028787801.1 thioredoxin-like protein YLS8 [Prosopis alba] >XP_029153776.1 thioredoxin-like protein YLS8 [Arachis hypogaea] >XP_031737353.1 thioredoxin-like protein YLS8 [Cucumis sativus] >XP_038902874.1 thioredoxin-like protein YLS8 [Benincasa hispida] >XP_038902875.1 thioredoxin-like protein YLS8 [Benincasa hispida] >XP_039013197.1 thioredoxin-like protein YLS8 [Hibiscus syriacus] >XP_039019395.1 thioredoxin-like protein YLS8 [Hibiscus syriacus] >XP_039047757.1 thioredoxin-like protein YLS8 [Hibiscus syriacus] >XP_039137675.1 thioredoxin-like protein YLS8 [Dioscorea cayenensis subsp. rotundata] >AGH25793.1 YLS8 [Gossypium hirsutum] >KAA3463630.1 thioredoxin-like protein YLS8 [Gossypium australe] >KAB2035695.1 hypothetical protein ES319_D04G171200v1 [Gossypium barbadense] >KAE9594226.1 putative Dim1 family, thioredoxin-like protein [Lupinus albus] >KAG6571422.1 Thioredoxin-like protein YLS8, partial [Cucurbita argyrosperma subsp. sororia] >KAG7011188.1 Thioredoxin-like protein YLS8, partial [Cucurbita argyrosperma subsp. argyrosperma] >MBA0630926.1 hypothetical protein [Gossypium davidsonii] >MBA0666643.1 hypothetical protein [Gossypium klotzschianum] >OVA18434.1 mRNA splicing factor [Macleaya cordata] >RWR92604.1 thioredoxin-like protein YLS8 [Cinnamomum micranthum f. kanehirae] >TYG74413.1 hypothetical protein ES288_D04G181300v1 [Gossypium darwinii] >TYH77829.1 hypothetical protein ES332_D04G182700v1 [Gossypium tomentosum] >TYI87952.1 hypothetical protein E1A91_D04G173100v1 [Gossypium mustelinum] >CAA2627361.1 unnamed protein product [Spirodela intermedia] >CAA7027004.1 unnamed protein product [Microthlaspi erraticum]) HSP 1 Score: 295 bits (754), Expect = 3.85e-100 Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of Chy11G187410 vs. NCBI nr
Match: NP_001341033.1 (DIM 1-like protein [Glycine max] >XP_002283622.1 PREDICTED: thioredoxin-like protein YLS8 [Vitis vinifera] >XP_002310072.1 thioredoxin-like protein YLS8 isoform X1 [Populus trichocarpa] >XP_002529724.1 thioredoxin-like protein YLS8 [Ricinus communis] >XP_003554015.1 thioredoxin-like protein YLS8 [Glycine max] >XP_007043276.1 PREDICTED: thioredoxin-like protein YLS8 isoform X1 [Theobroma cacao] >XP_009407394.1 PREDICTED: thioredoxin-like protein YLS8 [Musa acuminata subsp. malaccensis] >XP_009413118.1 PREDICTED: thioredoxin-like protein YLS8 [Musa acuminata subsp. malaccensis] >XP_010067004.1 thioredoxin-like protein YLS8 isoform X1 [Eucalyptus grandis] >XP_010274887.1 PREDICTED: thioredoxin-like protein YLS8 [Nelumbo nucifera] >XP_011002244.1 PREDICTED: thioredoxin-like protein YLS8 isoform X1 [Populus euphratica] >XP_011002246.1 PREDICTED: thioredoxin-like protein YLS8 isoform X1 [Populus euphratica] >XP_012066576.1 thioredoxin-like protein YLS8 [Jatropha curcas] >XP_020202007.1 thioredoxin-like protein YLS8 [Cajanus cajan] >XP_020524920.1 thioredoxin-like protein YLS8 [Amborella trichopoda] >XP_021294002.1 thioredoxin-like protein YLS8 [Herrania umbratica] >XP_022726013.1 thioredoxin-like protein YLS8 [Durio zibethinus] >XP_022743304.1 thioredoxin-like protein YLS8 [Durio zibethinus] >XP_027360456.1 thioredoxin-like protein YLS8 [Abrus precatorius] >XP_028219104.1 thioredoxin-like protein YLS8 [Glycine soja] >XP_028248086.1 thioredoxin-like protein YLS8 [Glycine soja] >XP_030457582.1 thioredoxin-like protein YLS8 isoform X1 [Syzygium oleosum] >XP_030547602.1 thioredoxin-like protein YLS8 isoform X1 [Rhodamnia argentea] >XP_031272353.1 thioredoxin-like protein YLS8 isoform X1 [Pistacia vera] >XP_031380585.1 thioredoxin-like protein YLS8 isoform X1 [Punica granatum] >XP_034686832.1 thioredoxin-like protein YLS8 [Vitis riparia] >XP_034915705.1 thioredoxin-like protein YLS8 [Populus alba] >KAA8528915.1 hypothetical protein F0562_033597 [Nyssa sinensis] >KAF8021739.1 hypothetical protein BT93_G2016 [Corymbia citriodora subsp. variegata] >KAF9599116.1 hypothetical protein IFM89_035395 [Coptis chinensis] >PON34927.1 Thioredoxin-like protein [Parasponia andersonii] >POO03557.1 Thioredoxin-like protein [Trema orientale] >RDX77683.1 Thioredoxin-like protein YLS8 [Mucuna pruriens] >THU69300.1 hypothetical protein C4D60_Mb08t12990 [Musa balbisiana] >TKY69085.1 Thioredoxin protein YLS8 [Spatholobus suberectus] >GAV72260.1 DIM1 domain-containing protein [Cephalotus follicularis]) HSP 1 Score: 294 bits (753), Expect = 5.47e-100 Identity = 141/142 (99.30%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of Chy11G187410 vs. TAIR 10
Match: AT5G08290.1 (mRNA splicing factor, thioredoxin-like U5 snRNP ) HSP 1 Score: 295.8 bits (756), Expect = 2.3e-80 Identity = 141/142 (99.30%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of Chy11G187410 vs. TAIR 10
Match: AT3G24730.1 (mRNA splicing factor, thioredoxin-like U5 snRNP ) HSP 1 Score: 97.1 bits (240), Expect = 1.5e-20 Identity = 53/138 (38.41%), Postives = 79/138 (57.25%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (hystrix) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|