Carg21157 (gene) Silver-seed gourd (SMH-JMG-627) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCAGGCGTTTGGGTTTTCCGATCAAACGGCGTGATGCGCCTCGTGGAAAACTCCCAAGCCGGCGGCGGCACCGGCACCGGCGCGGACTACTCCTCCGGCGGCGGCGGAAGAAAGAAGGTTCTGGTTCATCTTCCGTCGGGGCAGCCGGTTTGTTCTTACGGATTCCTTGAGAAGATTCTGGAAGGTTTAGGATGGGAGCGATATTACGAAGGCGATCCAGATTTGTTCCAGTTTCATAAGCTTTCTTCCATTGATCTAATTTCTCTTCCAATGGAGTTCTCCAAATTCAACTCCGTTTACATGTACGATCTCGTCGTCAAAAACCCTAACGTCTTCCACGTTCGAGAACCCTAA ATGTCAGGCGTTTGGGTTTTCCGATCAAACGGCGTGATGCGCCTCGTGGAAAACTCCCAAGCCGGCGGCGGCACCGGCACCGGCGCGGACTACTCCTCCGGCGGCGGCGGAAGAAAGAAGGTTCTGGTTCATCTTCCGTCGGGGCAGCCGGTTTGTTCTTACGGATTCCTTGAGAAGATTCTGGAAGGTTTAGGATGGGAGCGATATTACGAAGGCGATCCAGATTTGTTCCAGTTTCATAAGCTTTCTTCCATTGATCTAATTTCTCTTCCAATGGAGTTCTCCAAATTCAACTCCGTTTACATGTACGATCTCGTCGTCAAAAACCCTAACGTCTTCCACGTTCGAGAACCCTAA ATGTCAGGCGTTTGGGTTTTCCGATCAAACGGCGTGATGCGCCTCGTGGAAAACTCCCAAGCCGGCGGCGGCACCGGCACCGGCGCGGACTACTCCTCCGGCGGCGGCGGAAGAAAGAAGGTTCTGGTTCATCTTCCGTCGGGGCAGCCGGTTTGTTCTTACGGATTCCTTGAGAAGATTCTGGAAGGTTTAGGATGGGAGCGATATTACGAAGGCGATCCAGATTTGTTCCAGTTTCATAAGCTTTCTTCCATTGATCTAATTTCTCTTCCAATGGAGTTCTCCAAATTCAACTCCGTTTACATGTACGATCTCGTCGTCAAAAACCCTAACGTCTTCCACGTTCGAGAACCCTAA MSGVWVFRSNGVMRLVENSQAGGGTGTGADYSSGGGGRKKVLVHLPSGQPVCSYGFLEKILEGLGWERYYEGDPDLFQFHKLSSIDLISLPMEFSKFNSVYMYDLVVKNPNVFHVREP Homology
BLAST of Carg21157 vs. NCBI nr
Match: XP_022940479.1 (flowering-promoting factor 1-like protein 2 [Cucurbita moschata] >KAG7037549.1 Flowering-promoting factor 1-like protein 2, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 246.9 bits (629), Expect = 8.7e-62 Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 0
BLAST of Carg21157 vs. NCBI nr
Match: KAG6608191.1 (Flowering-promoting factor 1-like protein 2, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 244.6 bits (623), Expect = 4.3e-61 Identity = 117/118 (99.15%), Postives = 117/118 (99.15%), Query Frame = 0
BLAST of Carg21157 vs. NCBI nr
Match: XP_022982497.1 (flowering-promoting factor 1-like protein 2 [Cucurbita maxima]) HSP 1 Score: 234.6 bits (597), Expect = 4.5e-58 Identity = 115/124 (92.74%), Postives = 116/124 (93.55%), Query Frame = 0
BLAST of Carg21157 vs. NCBI nr
Match: XP_023524426.1 (flowering-promoting factor 1-like protein 2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 230.7 bits (587), Expect = 6.5e-57 Identity = 115/122 (94.26%), Postives = 116/122 (95.08%), Query Frame = 0
BLAST of Carg21157 vs. NCBI nr
Match: XP_004136318.1 (flowering-promoting factor 1-like protein 2 [Cucumis sativus] >KGN60157.1 hypothetical protein Csa_002053 [Cucumis sativus]) HSP 1 Score: 210.7 bits (535), Expect = 6.9e-51 Identity = 102/123 (82.93%), Postives = 108/123 (87.80%), Query Frame = 0
BLAST of Carg21157 vs. ExPASy Swiss-Prot
Match: Q5Q0B3 (Flowering-promoting factor 1-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FLP1 PE=2 SV=2) HSP 1 Score: 153.7 bits (387), Expect = 1.3e-36 Identity = 80/124 (64.52%), Postives = 92/124 (74.19%), Query Frame = 0
BLAST of Carg21157 vs. ExPASy Swiss-Prot
Match: Q9LXB5 (Flowering-promoting factor 1-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=FLP2 PE=2 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 5.0e-36 Identity = 76/117 (64.96%), Postives = 89/117 (76.07%), Query Frame = 0
BLAST of Carg21157 vs. ExPASy Swiss-Prot
Match: O24340 (Flowering-promoting factor 1 OS=Sinapis alba OX=3728 GN=FPF1 PE=2 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 3.0e-33 Identity = 74/119 (62.18%), Postives = 92/119 (77.31%), Query Frame = 0
BLAST of Carg21157 vs. ExPASy Swiss-Prot
Match: O23624 (Flowering-promoting factor 1 OS=Arabidopsis thaliana OX=3702 GN=FPF1 PE=1 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 6.8e-33 Identity = 74/118 (62.71%), Postives = 88/118 (74.58%), Query Frame = 0
BLAST of Carg21157 vs. ExPASy Swiss-Prot
Match: Q9LGE3 (Flowering-promoting factor 1-like protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=RAA1 PE=1 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 2.4e-30 Identity = 72/115 (62.61%), Postives = 81/115 (70.43%), Query Frame = 0
BLAST of Carg21157 vs. ExPASy TrEMBL
Match: A0A6J1FKC3 (flowering-promoting factor 1-like protein 2 OS=Cucurbita moschata OX=3662 GN=LOC111446065 PE=3 SV=1) HSP 1 Score: 246.9 bits (629), Expect = 4.2e-62 Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 0
BLAST of Carg21157 vs. ExPASy TrEMBL
Match: A0A6J1IWR8 (flowering-promoting factor 1-like protein 2 OS=Cucurbita maxima OX=3661 GN=LOC111481300 PE=3 SV=1) HSP 1 Score: 234.6 bits (597), Expect = 2.2e-58 Identity = 115/124 (92.74%), Postives = 116/124 (93.55%), Query Frame = 0
BLAST of Carg21157 vs. ExPASy TrEMBL
Match: A0A0A0LHE6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G881700 PE=3 SV=1) HSP 1 Score: 210.7 bits (535), Expect = 3.3e-51 Identity = 102/123 (82.93%), Postives = 108/123 (87.80%), Query Frame = 0
BLAST of Carg21157 vs. ExPASy TrEMBL
Match: A0A6J1IMX4 (flowering-promoting factor 1-like protein 2 OS=Cucurbita maxima OX=3661 GN=LOC111476674 PE=3 SV=1) HSP 1 Score: 208.4 bits (529), Expect = 1.7e-50 Identity = 100/119 (84.03%), Postives = 107/119 (89.92%), Query Frame = 0
BLAST of Carg21157 vs. ExPASy TrEMBL
Match: A0A5A7UF14 (Flowering-promoting factor 1-like protein 2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold64983G00010 PE=3 SV=1) HSP 1 Score: 208.0 bits (528), Expect = 2.2e-50 Identity = 102/129 (79.07%), Postives = 107/129 (82.95%), Query Frame = 0
BLAST of Carg21157 vs. TAIR 10
Match: AT4G31380.1 (FPF1-like protein 1 ) HSP 1 Score: 153.7 bits (387), Expect = 9.3e-38 Identity = 80/124 (64.52%), Postives = 92/124 (74.19%), Query Frame = 0
BLAST of Carg21157 vs. TAIR 10
Match: AT5G10625.1 (BEST Arabidopsis thaliana protein match is: flowering promoting factor 1 (TAIR:AT5G24860.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). ) HSP 1 Score: 151.8 bits (382), Expect = 3.5e-37 Identity = 76/117 (64.96%), Postives = 89/117 (76.07%), Query Frame = 0
BLAST of Carg21157 vs. TAIR 10
Match: AT5G24860.1 (flowering promoting factor 1 ) HSP 1 Score: 141.4 bits (355), Expect = 4.8e-34 Identity = 74/118 (62.71%), Postives = 88/118 (74.58%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (SMH-JMG-627) v2
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|