![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
CaUC06G119610 (gene) Watermelon (USVL246-FR2) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGATATTCCTTTTCCTGGTAAGCTTAATTCAAAACTTTTAATCGTTCTTCTAAACCTTTCCAAAATATTTATAAATCCACGTTTGTTTTTCTATAGAGAAAGAATAGACAATCTTAATTATATTTTTGTAGTGTAAATGATTATTTCAACCTAAAATGATCATAGTATTTATTTACTTTTGCCAAACAAATGTCTTTAACGTTGACAAAAAGATGTTGGTTTTCAAATGTTGTTTGAATCTAGTCCAATATTTAGAGATGAGTTTTAAAACTAGTTATTGATTTGCTACACATTTGTAAGTAGTATGTACTAATTATTGAAAAATTATTACGTTGAACTAGGAAAAGCATCATGGCCGGAACTTGTGGGAATTGAAGCTGAAATTTCAAAGCATATCATACCGAAAGAGAATCCTCGTGTGAAAATTATTGAAATCATATTAGCTGGTAGTCCAGTGACTCAAGACTTGAGGGAGGACAGAGTTCGAATCTTTGTGAACATACGAAACGTTGCAGTTGAAATACCAAAGATTGGCTAA ATGGCTGATATTCCTTTTCCTGGTAAGCTTAATTCAAAACTTTTAATCGTTCTTCTAAACCTTTCCAAAATATTTATAAATCCACGAAAAGCATCATGGCCGGAACTTGTGGGAATTGAAGCTGAAATTTCAAAGCATATCATACCGAAAGAGAATCCTCGTGTGAAAATTATTGAAATCATATTAGCTGGTAGTCCAGTGACTCAAGACTTGAGGGAGGACAGAGTTCGAATCTTTGTGAACATACGAAACGTTGCAGTTGAAATACCAAAGATTGGCTAA ATGGCTGATATTCCTTTTCCTGGTAAGCTTAATTCAAAACTTTTAATCGTTCTTCTAAACCTTTCCAAAATATTTATAAATCCACGAAAAGCATCATGGCCGGAACTTGTGGGAATTGAAGCTGAAATTTCAAAGCATATCATACCGAAAGAGAATCCTCGTGTGAAAATTATTGAAATCATATTAGCTGGTAGTCCAGTGACTCAAGACTTGAGGGAGGACAGAGTTCGAATCTTTGTGAACATACGAAACGTTGCAGTTGAAATACCAAAGATTGGCTAA MADIPFPGKLNSKLLIVLLNLSKIFINPRKASWPELVGIEAEISKHIIPKENPRVKIIEIILAGSPVTQDLREDRVRIFVNIRNVAVEIPKIG Homology
BLAST of CaUC06G119610 vs. NCBI nr
Match: KAG6571494.1 (hypothetical protein SDJN03_28222, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 86.3 bits (212), Expect = 1.5e-13 Identity = 42/69 (60.87%), Postives = 53/69 (76.81%), Query Frame = 0
BLAST of CaUC06G119610 vs. NCBI nr
Match: KGN50840.1 (hypothetical protein Csa_004718 [Cucumis sativus]) HSP 1 Score: 80.9 bits (198), Expect = 6.5e-12 Identity = 35/66 (53.03%), Postives = 51/66 (77.27%), Query Frame = 0
BLAST of CaUC06G119610 vs. NCBI nr
Match: XP_015055202.1 (trypsin inhibitor 1-like [Solanum pennellii]) HSP 1 Score: 79.7 bits (195), Expect = 1.4e-11 Identity = 34/65 (52.31%), Postives = 50/65 (76.92%), Query Frame = 0
BLAST of CaUC06G119610 vs. NCBI nr
Match: KAG6571499.1 (Proteinase inhibitor I-B, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 79.0 bits (193), Expect = 2.5e-11 Identity = 41/69 (59.42%), Postives = 46/69 (66.67%), Query Frame = 0
BLAST of CaUC06G119610 vs. NCBI nr
Match: XP_004249689.1 (trypsin inhibitor 1-like [Solanum lycopersicum] >XP_015055258.1 trypsin inhibitor 1-like [Solanum pennellii] >TMW99689.1 hypothetical protein EJD97_002136 [Solanum chilense]) HSP 1 Score: 78.6 bits (192), Expect = 3.2e-11 Identity = 40/90 (44.44%), Postives = 60/90 (66.67%), Query Frame = 0
BLAST of CaUC06G119610 vs. ExPASy Swiss-Prot
Match: P20076 (Ethylene-responsive proteinase inhibitor 1 OS=Solanum lycopersicum OX=4081 PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 8.0e-13 Identity = 33/64 (51.56%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of CaUC06G119610 vs. ExPASy Swiss-Prot
Match: Q02214 (Trypsin inhibitor 1 OS=Nicotiana sylvestris OX=4096 PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.8e-12 Identity = 30/65 (46.15%), Postives = 49/65 (75.38%), Query Frame = 0
BLAST of CaUC06G119610 vs. ExPASy Swiss-Prot
Match: P16231 (Wound-induced proteinase inhibitor 1 OS=Solanum peruvianum OX=4082 PE=3 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 2.3e-12 Identity = 35/63 (55.56%), Postives = 45/63 (71.43%), Query Frame = 0
BLAST of CaUC06G119610 vs. ExPASy Swiss-Prot
Match: Q00783 (Proteinase inhibitor 1 OS=Solanum tuberosum OX=4113 PE=3 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 6.8e-12 Identity = 35/76 (46.05%), Postives = 49/76 (64.47%), Query Frame = 0
BLAST of CaUC06G119610 vs. ExPASy Swiss-Prot
Match: Q03198 (Proteinase inhibitor I-A OS=Nicotiana tabacum OX=4097 GN=TIMPB PE=2 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.2e-11 Identity = 32/64 (50.00%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of CaUC06G119610 vs. ExPASy TrEMBL
Match: A0A0A0KME7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G286040 PE=3 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 3.2e-12 Identity = 35/66 (53.03%), Postives = 51/66 (77.27%), Query Frame = 0
BLAST of CaUC06G119610 vs. ExPASy TrEMBL
Match: A0A3Q7IMV8 (Uncharacterized protein OS=Solanum lycopersicum OX=4081 GN=101254438 PE=3 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 1.6e-11 Identity = 35/65 (53.85%), Postives = 49/65 (75.38%), Query Frame = 0
BLAST of CaUC06G119610 vs. ExPASy TrEMBL
Match: A0A3Q7IN73 (Uncharacterized protein OS=Solanum lycopersicum OX=4081 GN=101256437 PE=3 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 1.6e-11 Identity = 40/90 (44.44%), Postives = 60/90 (66.67%), Query Frame = 0
BLAST of CaUC06G119610 vs. ExPASy TrEMBL
Match: A0A6N2C3W9 (Uncharacterized protein OS=Solanum chilense OX=4083 GN=EJD97_002136 PE=3 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 1.6e-11 Identity = 40/90 (44.44%), Postives = 60/90 (66.67%), Query Frame = 0
BLAST of CaUC06G119610 vs. ExPASy TrEMBL
Match: M1BHH1 (Trypsin inhibitor 1 OS=Solanum tuberosum OX=4113 GN=102586688 PE=3 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 2.0e-11 Identity = 34/65 (52.31%), Postives = 49/65 (75.38%), Query Frame = 0
BLAST of CaUC06G119610 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 66.6 bits (161), Expect = 1.2e-11 Identity = 33/66 (50.00%), Postives = 42/66 (63.64%), Query Frame = 0
BLAST of CaUC06G119610 vs. TAIR 10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 57.8 bits (138), Expect = 5.5e-09 Identity = 30/73 (41.10%), Postives = 48/73 (65.75%), Query Frame = 0
BLAST of CaUC06G119610 vs. TAIR 10
Match: AT2G38900.2 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 45.8 bits (107), Expect = 2.2e-05 Identity = 25/76 (32.89%), Postives = 42/76 (55.26%), Query Frame = 0
BLAST of CaUC06G119610 vs. TAIR 10
Match: AT2G38900.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 43.1 bits (100), Expect = 1.4e-04 Identity = 22/64 (34.38%), Postives = 37/64 (57.81%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (USVL246-FR2) v1
Date Performed: 2022-01-31 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|