
MELO3C000076 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GAGCTACCGGAACAACAACGAAGCGATGCAGTAAGTTCGATGGTGTATGAGGCAAACGCAAGGGTACGAGATCCCGTGTATGGTTGTGTTGGAGCCATATCATCGTTACAACAACAGATTGATCTCTTGCAAACACAACTAGCAATAGCGCAAGCGGAGGTGGTTCACATGCGGATGCGCCACATCCCGTCATCCTCTTACAACCCAACGATGGGCCACTCATCGGAAACCGCCTCGCCCTCCAGCAAGATGAACATTCCGGTGCCAAACAAGTCCTATTTTTCCATGGACATGGTTGACCACGACAGCATGGGGGAGACCTTGTGGTCGTCTTGCTAG GAGCTACCGGAACAACAACGAAGCGATGCAGTAAGTTCGATGGTGTATGAGGCAAACGCAAGGGTACGAGATCCCGTGTATGGTTGTGTTGGAGCCATATCATCGTTACAACAACAGATTGATCTCTTGCAAACACAACTAGCAATAGCGCAAGCGGAGGTGGTTCACATGCGGATGCGCCACATCCCGTCATCCTCTTACAACCCAACGATGGGCCACTCATCGGAAACCGCCTCGCCCTCCAGCAAGATGAACATTCCGGTGCCAAACAAGTCCTATTTTTCCATGGACATGGTTGACCACGACAGCATGGGGGAGACCTTGTGGTCGTCTTGCTAG ATGGTGTATGAGGCAAACGCAAGGGTACGAGATCCCGTGTATGGTTGTGTTGGAGCCATATCATCGTTACAACAACAGATTGATCTCTTGCAAACACAACTAGCAATAGCGCAAGCGGAGGTGGTTCACATGCGGATGCGCCACATCCCGTCATCCTCTTACAACCCAACGATGGGCCACTCATCGGAAACCGCCTCGCCCTCCAGCAAGATGAACATTCCGGTGCCAAACAAGTCCTATTTTTCCATGGACATGGTTGACCACGACAGCATGGGGGAGACCTTGTGGTCGTCTTGCTAG MVYEANARVRDPVYGCVGAISSLQQQIDLLQTQLAIAQAEVVHMRMRHIPSSSYNPTMGHSSETASPSSKMNIPVPNKSYFSMDMVDHDSMGETLWSSC Homology
BLAST of MELO3C000076 vs. ExPASy Swiss-Prot
Match: Q9SHE9 (LOB domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=LBD4 PE=1 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 4.8e-24 Identity = 65/101 (64.36%), Postives = 74/101 (73.27%), Query Frame = 0
BLAST of MELO3C000076 vs. ExPASy Swiss-Prot
Match: Q9SA51 (LOB domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=LBD3 PE=2 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 4.5e-14 Identity = 46/100 (46.00%), Postives = 61/100 (61.00%), Query Frame = 0
BLAST of MELO3C000076 vs. ExPASy Swiss-Prot
Match: Q8LBW3 (LOB domain-containing protein 12 OS=Arabidopsis thaliana OX=3702 GN=LBD12 PE=1 SV=2) HSP 1 Score: 70.5 bits (171), Expect = 1.2e-11 Identity = 33/51 (64.71%), Postives = 44/51 (86.27%), Query Frame = 0
BLAST of MELO3C000076 vs. ExPASy Swiss-Prot
Match: Q9LQR0 (LOB domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=LBD1 PE=2 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.0e-09 Identity = 30/47 (63.83%), Postives = 37/47 (78.72%), Query Frame = 0
BLAST of MELO3C000076 vs. ExPASy Swiss-Prot
Match: Q8L5T5 (LOB domain-containing protein 15 OS=Arabidopsis thaliana OX=3702 GN=LBD15 PE=1 SV=2) HSP 1 Score: 61.6 bits (148), Expect = 5.7e-09 Identity = 29/59 (49.15%), Postives = 42/59 (71.19%), Query Frame = 0
BLAST of MELO3C000076 vs. NCBI nr
Match: XP_008467061.2 (PREDICTED: LOB domain-containing protein 4-like, partial [Cucumis melo]) HSP 1 Score: 199.5 bits (506), Expect = 1.3e-47 Identity = 99/99 (100.00%), Postives = 99/99 (100.00%), Query Frame = 0
BLAST of MELO3C000076 vs. NCBI nr
Match: KAA0054642.1 (LOB domain-containing protein 4-like [Cucumis melo var. makuwa] >TYK08620.1 LOB domain-containing protein 4-like [Cucumis melo var. makuwa]) HSP 1 Score: 199.5 bits (506), Expect = 1.3e-47 Identity = 99/99 (100.00%), Postives = 99/99 (100.00%), Query Frame = 0
BLAST of MELO3C000076 vs. NCBI nr
Match: XP_004150042.1 (LOB domain-containing protein 4 [Cucumis sativus] >KGN46813.1 hypothetical protein Csa_020952 [Cucumis sativus]) HSP 1 Score: 192.2 bits (487), Expect = 2.1e-45 Identity = 95/99 (95.96%), Postives = 95/99 (95.96%), Query Frame = 0
BLAST of MELO3C000076 vs. NCBI nr
Match: XP_038902133.1 (LOB domain-containing protein 4-like [Benincasa hispida]) HSP 1 Score: 177.2 bits (448), Expect = 7.1e-41 Identity = 88/99 (88.89%), Postives = 92/99 (92.93%), Query Frame = 0
BLAST of MELO3C000076 vs. NCBI nr
Match: XP_022947417.1 (LOB domain-containing protein 4-like [Cucurbita moschata] >XP_022970811.1 LOB domain-containing protein 4-like [Cucurbita maxima] >KAG6604717.1 LOB domain-containing protein 4, partial [Cucurbita argyrosperma subsp. sororia] >KAG7034846.1 LOB domain-containing protein 4, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 154.5 bits (389), Expect = 4.9e-34 Identity = 81/99 (81.82%), Postives = 85/99 (85.86%), Query Frame = 0
BLAST of MELO3C000076 vs. ExPASy TrEMBL
Match: A0A5D3CBA3 (LOB domain-containing protein 4-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold3734G00510 PE=3 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 6.5e-48 Identity = 99/99 (100.00%), Postives = 99/99 (100.00%), Query Frame = 0
BLAST of MELO3C000076 vs. ExPASy TrEMBL
Match: A0A1S3CSM8 (LOB domain-containing protein 4-like OS=Cucumis melo OX=3656 GN=LOC103504497 PE=3 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 6.5e-48 Identity = 99/99 (100.00%), Postives = 99/99 (100.00%), Query Frame = 0
BLAST of MELO3C000076 vs. ExPASy TrEMBL
Match: A0A0A0KBA8 (LOB domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G139130 PE=3 SV=1) HSP 1 Score: 192.2 bits (487), Expect = 1.0e-45 Identity = 95/99 (95.96%), Postives = 95/99 (95.96%), Query Frame = 0
BLAST of MELO3C000076 vs. ExPASy TrEMBL
Match: A0A6J1I1K8 (LOB domain-containing protein 4-like OS=Cucurbita maxima OX=3661 GN=LOC111469678 PE=3 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 2.4e-34 Identity = 81/99 (81.82%), Postives = 85/99 (85.86%), Query Frame = 0
BLAST of MELO3C000076 vs. ExPASy TrEMBL
Match: A0A6J1G6E3 (LOB domain-containing protein 4-like OS=Cucurbita moschata OX=3662 GN=LOC111451283 PE=3 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 2.4e-34 Identity = 81/99 (81.82%), Postives = 85/99 (85.86%), Query Frame = 0
BLAST of MELO3C000076 vs. TAIR 10
Match: AT1G31320.1 (LOB domain-containing protein 4 ) HSP 1 Score: 111.7 bits (278), Expect = 3.4e-25 Identity = 65/101 (64.36%), Postives = 74/101 (73.27%), Query Frame = 0
BLAST of MELO3C000076 vs. TAIR 10
Match: AT1G16530.1 (ASYMMETRIC LEAVES 2-like 9 ) HSP 1 Score: 78.6 bits (192), Expect = 3.2e-15 Identity = 46/100 (46.00%), Postives = 61/100 (61.00%), Query Frame = 0
BLAST of MELO3C000076 vs. TAIR 10
Match: AT2G30130.1 (Lateral organ boundaries (LOB) domain family protein ) HSP 1 Score: 70.5 bits (171), Expect = 8.7e-13 Identity = 33/51 (64.71%), Postives = 44/51 (86.27%), Query Frame = 0
BLAST of MELO3C000076 vs. TAIR 10
Match: AT1G07900.1 (LOB domain-containing protein 1 ) HSP 1 Score: 63.2 bits (152), Expect = 1.4e-10 Identity = 30/47 (63.83%), Postives = 37/47 (78.72%), Query Frame = 0
BLAST of MELO3C000076 vs. TAIR 10
Match: AT2G40470.1 (LOB domain-containing protein 15 ) HSP 1 Score: 61.6 bits (148), Expect = 4.1e-10 Identity = 29/59 (49.15%), Postives = 42/59 (71.19%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
|