MC08g0576 (gene) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTTTTAACATTCCATTTTCTTTTTCTCATTCTTTTTGGTGTGTCTTTAATTTGTTGGGTTAAATTAGGTGAAGGTAGTTTCTGCAACTGGAAATGCAAAGAAAGATGCGCAAAAGCTGGAGTCCAGGATCGGTGCATCAAATACTGCGGGATCTGCTGCGAGAAGTGCCACTGCGTGCCATCAGGGACCTACGGGAATAAGCACGAGTGCCCTTGCTATGCCCAAATGAAAAACTCCAAGCGCAAGCCCAAGTGCCCT TTTTTAACATTCCATTTTCTTTTTCTCATTCTTTTTGGTGTGTCTTTAATTTGTTGGGTTAAATTAGGTGAAGGTAGTTTCTGCAACTGGAAATGCAAAGAAAGATGCGCAAAAGCTGGAGTCCAGGATCGGTGCATCAAATACTGCGGGATCTGCTGCGAGAAGTGCCACTGCGTGCCATCAGGGACCTACGGGAATAAGCACGAGTGCCCTTGCTATGCCCAAATGAAAAACTCCAAGCGCAAGCCCAAGTGCCCT TTTTTAACATTCCATTTTCTTTTTCTCATTCTTTTTGGTGTGTCTTTAATTTGTTGGGTTAAATTAGGTGAAGGTAGTTTCTGCAACTGGAAATGCAAAGAAAGATGCGCAAAAGCTGGAGTCCAGGATCGGTGCATCAAATACTGCGGGATCTGCTGCGAGAAGTGCCACTGCGTGCCATCAGGGACCTACGGGAATAAGCACGAGTGCCCTTGCTATGCCCAAATGAAAAACTCCAAGCGCAAGCCCAAGTGCCCT FLTFHFLFLILFGVSLICWVKLGEGSFCNWKCKERCAKAGVQDRCIKYCGICCEKCHCVPSGTYGNKHECPCYAQMKNSKRKPKCP Homology
BLAST of MC08g0576 vs. ExPASy Swiss-Prot
Match: P86888 (Peamaclein OS=Prunus persica OX=3760 PE=1 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.9e-25 Identity = 47/61 (77.05%), Postives = 52/61 (85.25%), Query Frame = 0
BLAST of MC08g0576 vs. ExPASy Swiss-Prot
Match: Q948Z4 (Snakin-1 OS=Solanum tuberosum OX=4113 GN=SN1 PE=1 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 7.1e-24 Identity = 54/86 (62.79%), Postives = 61/86 (70.93%), Query Frame = 0
BLAST of MC08g0576 vs. ExPASy Swiss-Prot
Match: Q8LFM2 (Gibberellin-regulated protein 10 OS=Arabidopsis thaliana OX=3702 GN=GASA10 PE=2 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 4.3e-21 Identity = 48/81 (59.26%), Postives = 55/81 (67.90%), Query Frame = 0
BLAST of MC08g0576 vs. ExPASy Swiss-Prot
Match: C0HLQ1 (Cypmaclein OS=Cryptomeria japonica OX=3369 PE=1 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 2.8e-20 Identity = 39/59 (66.10%), Postives = 46/59 (77.97%), Query Frame = 0
BLAST of MC08g0576 vs. ExPASy Swiss-Prot
Match: O82328 (Gibberellin-regulated protein 7 OS=Arabidopsis thaliana OX=3702 GN=GASA7 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 3.7e-20 Identity = 39/60 (65.00%), Postives = 47/60 (78.33%), Query Frame = 0
BLAST of MC08g0576 vs. NCBI nr
Match: XP_022132053.1 (peamaclein-like [Momordica charantia]) HSP 1 Score: 153 bits (386), Expect = 2.29e-46 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MC08g0576 vs. NCBI nr
Match: XP_004142881.1 (peamaclein [Cucumis sativus] >KGN62465.1 hypothetical protein Csa_018588 [Cucumis sativus]) HSP 1 Score: 123 bits (308), Expect = 1.65e-34 Identity = 49/67 (73.13%), Postives = 55/67 (82.09%), Query Frame = 0
BLAST of MC08g0576 vs. NCBI nr
Match: XP_023546651.1 (peamaclein [Cucurbita pepo subsp. pepo]) HSP 1 Score: 122 bits (307), Expect = 2.34e-34 Identity = 52/67 (77.61%), Postives = 55/67 (82.09%), Query Frame = 0
BLAST of MC08g0576 vs. NCBI nr
Match: XP_031270688.1 (peamaclein [Pistacia vera]) HSP 1 Score: 122 bits (306), Expect = 3.63e-34 Identity = 55/81 (67.90%), Postives = 62/81 (76.54%), Query Frame = 0
BLAST of MC08g0576 vs. NCBI nr
Match: KAB5526627.1 (hypothetical protein DKX38_020474 [Salix brachista]) HSP 1 Score: 122 bits (306), Expect = 3.63e-34 Identity = 50/67 (74.63%), Postives = 55/67 (82.09%), Query Frame = 0
BLAST of MC08g0576 vs. ExPASy TrEMBL
Match: A0A6J1BV69 (peamaclein-like OS=Momordica charantia OX=3673 GN=LOC111005017 PE=3 SV=1) HSP 1 Score: 153 bits (386), Expect = 1.11e-46 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MC08g0576 vs. ExPASy TrEMBL
Match: A0A0A0LKN7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G354910 PE=3 SV=1) HSP 1 Score: 123 bits (308), Expect = 7.99e-35 Identity = 49/67 (73.13%), Postives = 55/67 (82.09%), Query Frame = 0
BLAST of MC08g0576 vs. ExPASy TrEMBL
Match: A0A5N5KDA5 (Uncharacterized protein OS=Salix brachista OX=2182728 GN=DKX38_020474 PE=3 SV=1) HSP 1 Score: 122 bits (306), Expect = 1.76e-34 Identity = 50/67 (74.63%), Postives = 55/67 (82.09%), Query Frame = 0
BLAST of MC08g0576 vs. ExPASy TrEMBL
Match: A0A6N2MX87 (Uncharacterized protein OS=Salix viminalis OX=40686 GN=SVIM_LOCUS377645 PE=3 SV=1) HSP 1 Score: 122 bits (305), Expect = 2.50e-34 Identity = 49/67 (73.13%), Postives = 55/67 (82.09%), Query Frame = 0
BLAST of MC08g0576 vs. ExPASy TrEMBL
Match: K0E174 (Gibberellin-regulated protein OS=Populus tomentosa OX=118781 GN=GASA PE=2 SV=1) HSP 1 Score: 121 bits (304), Expect = 3.55e-34 Identity = 49/67 (73.13%), Postives = 55/67 (82.09%), Query Frame = 0
BLAST of MC08g0576 vs. TAIR 10
Match: AT5G59845.1 (Gibberellin-regulated family protein ) HSP 1 Score: 101.7 bits (252), Expect = 3.1e-22 Identity = 48/81 (59.26%), Postives = 55/81 (67.90%), Query Frame = 0
BLAST of MC08g0576 vs. TAIR 10
Match: AT2G14900.1 (Gibberellin-regulated family protein ) HSP 1 Score: 98.6 bits (244), Expect = 2.6e-21 Identity = 39/60 (65.00%), Postives = 47/60 (78.33%), Query Frame = 0
BLAST of MC08g0576 vs. TAIR 10
Match: AT2G39540.1 (Gibberellin-regulated family protein ) HSP 1 Score: 96.7 bits (239), Expect = 9.9e-21 Identity = 39/61 (63.93%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of MC08g0576 vs. TAIR 10
Match: AT1G10588.2 (Gibberellin-regulated family protein ) HSP 1 Score: 87.0 bits (214), Expect = 7.8e-18 Identity = 41/80 (51.25%), Postives = 51/80 (63.75%), Query Frame = 0
BLAST of MC08g0576 vs. TAIR 10
Match: AT1G10588.1 (Gibberellin-regulated family protein ) HSP 1 Score: 86.7 bits (213), Expect = 1.0e-17 Identity = 41/82 (50.00%), Postives = 50/82 (60.98%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|