MELO.jh019644.1 (gene) Melon (Harukei-3) v1.41
Overview
Sequences
The following sequences are available for this feature:
Legend: exonstart_codonCDSpolypeptidestop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATTGTCGAAGTTGGGATGGCCTAAGGAAACCCTAGTATCTATATAAGCGAAAATGGCGGTGCCTTTGCTGTCGAAGAAGATCGTGAATAAGAGGACAAAGAAGTTCAAGAGGCCTCAGAGTGATCGAAAGATCTTCATCAAGGAAAATTGAAGAAGAACCGAGGGTATTGATTCTAGAGTGAGAAGAAAGTTTAAAGGACGCACATTGATGCCAAATATTGGTACAGTACCGACAAGAAGACCTGTCACTACCTGCCTAATGGGATCAAGAAGTTCATTGTTCATAATGTCAAGGAGCTCAAACTGTTGATGATGCACAACAGGATATACTGTGCCGAGATTGCTCATGATGTTTCAATAGAGAATAGGAAAGAGATTCTAGAGAGGGCAGCTCAACTTGATGTTGCAGTTACCAACAAGCTTGCTAGGTTGCACAGCCAAGAAGATGAATGAACAATTTAGGTCCTTAAATGCCAGTTTTCTTCATGCTACAATAAGACTTCGTTATTATATATCCTTTTTTGGTTCA ATTGTCGAAGTTGGGATGGCCTAAGGAAACCCTAGTATCTATATAAGCGAAAATGGCGGTGCCTTTGCTGTCGAAGAAGATCGTGAATAAGAGGACAAAGAAGTTCAAGAGGCCTCAGAGTGATCGAAAGATCTTCATCAAGGAAAATTGAAGAAGAACCGAGGGTATTGATTCTAGAGTGAGAAGAAAGTTTAAAGGACGCACATTGATGCCAAATATTGGTACAGTACCGACAAGAAGACCTGTCACTACCTGCCTAATGGGATCAAGAAGTTCATTGTTCATAATGTCAAGGAGCTCAAACTGTTGATGATGCACAACAGGATATACTGTGCCGAGATTGCTCATGATGTTTCAATAGAGAATAGGAAAGAGATTCTAGAGAGGGCAGCTCAACTTGATGTTGCAGTTACCAACAAGCTTGCTAGGTTGCACAGCCAAGAAGATGAATGAACAATTTAGGTCCTTAAATGCCAGTTTTCTTCATGCTACAATAAGACTTCGTTATTATATATCCTTTTTTGGTTCA ATGATGCACAACAGGATATACTGTGCCGAGATTGCTCATGATGTTTCAATAGAGAATAGGAAAGAGATTCTAGAGAGGGCAGCTCAACTTGATGTTGCAGTTACCAACAAGCTTGCTAGGTTGCACAGCCAAGAAGATGAATGA MMHNRIYCAEIAHDVSIENRKEILERAAQLDVAVTNKLARLHSQEDE Homology
BLAST of MELO.jh019644.1 vs. NCBI nr
Match: KAB2021925.1 (hypothetical protein ES319_D07G173500v1 [Gossypium barbadense]) HSP 1 Score: 81.6 bits (200), Expect = 3.61e-19 Identity = 40/47 (85.11%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MELO.jh019644.1 vs. NCBI nr
Match: XP_021600018.1 (60S ribosomal protein L32-1 [Manihot esculenta] >KAG8634628.1 hypothetical protein MANES_17G064800v8 [Manihot esculenta] >OAY25061.1 hypothetical protein MANES_17G064800v8 [Manihot esculenta]) HSP 1 Score: 83.2 bits (204), Expect = 8.31e-19 Identity = 41/47 (87.23%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MELO.jh019644.1 vs. NCBI nr
Match: MBA0700629.1 (hypothetical protein [Gossypium aridum] >MBA0739792.1 hypothetical protein [Gossypium gossypioides]) HSP 1 Score: 81.6 bits (200), Expect = 8.49e-19 Identity = 40/47 (85.11%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MELO.jh019644.1 vs. NCBI nr
Match: MBA0560458.1 (hypothetical protein [Gossypium lobatum]) HSP 1 Score: 81.6 bits (200), Expect = 8.49e-19 Identity = 40/47 (85.11%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MELO.jh019644.1 vs. NCBI nr
Match: VFQ95944.1 (unnamed protein product [Cuscuta campestris]) HSP 1 Score: 82.8 bits (203), Expect = 1.18e-18 Identity = 41/47 (87.23%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MELO.jh019644.1 vs. ExPASy Swiss-Prot
Match: P49211 (60S ribosomal protein L32-1 OS=Arabidopsis thaliana OX=3702 GN=RPL32A PE=2 SV=2) HSP 1 Score: 74.3 bits (181), Expect = 4.0e-13 Identity = 36/47 (76.60%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of MELO.jh019644.1 vs. ExPASy Swiss-Prot
Match: Q9FHG2 (60S ribosomal protein L32-2 OS=Arabidopsis thaliana OX=3702 GN=RPL32B PE=2 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 2.0e-12 Identity = 34/47 (72.34%), Postives = 40/47 (85.11%), Query Frame = 0
BLAST of MELO.jh019644.1 vs. ExPASy Swiss-Prot
Match: P51421 (60S ribosomal protein L32 (Fragment) OS=Zea mays OX=4577 GN=RPL32 PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 4.6e-09 Identity = 30/41 (73.17%), Postives = 34/41 (82.93%), Query Frame = 0
BLAST of MELO.jh019644.1 vs. ExPASy Swiss-Prot
Match: Q962T1 (60S ribosomal protein L32 OS=Spodoptera frugiperda OX=7108 GN=RpL32 PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 4.6e-09 Identity = 31/47 (65.96%), Postives = 35/47 (74.47%), Query Frame = 0
BLAST of MELO.jh019644.1 vs. ExPASy Swiss-Prot
Match: Q90YT6 (60S ribosomal protein L32 OS=Ictalurus punctatus OX=7998 GN=rpl32 PE=2 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 7.9e-09 Identity = 30/47 (63.83%), Postives = 38/47 (80.85%), Query Frame = 0
BLAST of MELO.jh019644.1 vs. ExPASy TrEMBL
Match: A0A0A0KXQ5 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G644575 PE=3 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 3.09e-20 Identity = 42/47 (89.36%), Postives = 44/47 (93.62%), Query Frame = 0
BLAST of MELO.jh019644.1 vs. ExPASy TrEMBL
Match: A0A5J5QRY2 (Uncharacterized protein OS=Gossypium barbadense OX=3634 GN=ES319_D07G173500v1 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 1.75e-19 Identity = 40/47 (85.11%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MELO.jh019644.1 vs. ExPASy TrEMBL
Match: A0A2C9U6K5 (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_17G064800 PE=3 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 4.02e-19 Identity = 41/47 (87.23%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MELO.jh019644.1 vs. ExPASy TrEMBL
Match: A0A7J9BUB1 (Uncharacterized protein OS=Gossypium gossypioides OX=34282 GN=Gogos_013028 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 4.11e-19 Identity = 40/47 (85.11%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MELO.jh019644.1 vs. ExPASy TrEMBL
Match: A0A7J8YNQ9 (Uncharacterized protein OS=Gossypium aridum OX=34290 GN=Goari_005673 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 4.11e-19 Identity = 40/47 (85.11%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MELO.jh019644.1 vs. TAIR 10
Match: AT4G18100.1 (Ribosomal protein L32e ) HSP 1 Score: 74.3 bits (181), Expect = 2.9e-14 Identity = 36/47 (76.60%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of MELO.jh019644.1 vs. TAIR 10
Match: AT5G46430.1 (Ribosomal protein L32e ) HSP 1 Score: 72.0 bits (175), Expect = 1.4e-13 Identity = 34/47 (72.34%), Postives = 40/47 (85.11%), Query Frame = 0
BLAST of MELO.jh019644.1 vs. TAIR 10
Match: AT5G46430.2 (Ribosomal protein L32e ) HSP 1 Score: 72.0 bits (175), Expect = 1.4e-13 Identity = 34/47 (72.34%), Postives = 40/47 (85.11%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Harukei-3) v1.41
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|